(data stored in ACNUC30630 zone)

EMBL: AP009256.PE24

AP009256.PE24        Location/Qualifiers
FT   CDS             complement(29202..31958)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0024"
FT                   /product="narrowly conserved hypothetical protein"
FT                   /note="Orthologue of BL0604_ Tfu_2554"
FT                   /note="Phosphoenolpyruvate carboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0024"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38805"
FT                   /db_xref="GOA:A0ZZC2"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018129"
FT                   /db_xref="InterPro:IPR021135"
FT                   /db_xref="InterPro:IPR033129"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZC2"
FT                   /protein_id="BAF38805.1"
FT                   /translation="MTTENEQITPADAAIVSSGTGTKGPEERDLPASLKEEMDLCLQIL
FT                   REVLGEFDENLLAKFDEVREHALKASDERFSGILTDTNPDQDDLQKVVDIIDKTDVHEA
FT                   QLLARAFTTYFHLANLCEENYRVSVLHSRENAVDDTQAVDPVNEMTCAYHQLINEMGPA
FT                   RAKELLDQLEFHPVFTAHPTEARRKAVEGKIRRISQLLEAHKLLGGSDKKENSRRLFNE
FT                   IDALFRTSPIALKKPTPVEEADTILDIFDNTLFYTIPQVYRRFDDWVLGDKAGLVPPVC
FT                   PAFFHPGSWIGSDRDGNPNVTAKVSRQVARKFSDHVLGALEIETRRVGKNLTMEAETTP
FT                   PSAELKSLWNHQKEMSERLTDKAALISTKELHRAVMLVMADRLKATIDRDADLMYHSCE
FT                   DYIADLKTVQRSLAEANAKRSAYGPLQDLIWQAETFGFHMVEMEFRQHSVVHSRALEDI
FT                   REHGLHGERGELQPMTHEVLDTFRALGSIQKRNGIKAARRYIISFTKSAQNIKDVYELN
FT                   RLAFSHPEDVPTIDVIPLFEQLEDLQNSVDVLEEMIKIPEVQARLKATGGKMEVMLGYS
FT                   DSSKDAGPTSATLALHSAQERIAKWAESHDIDLTLFHGRGGAVGRGGGPANRAVLAQPV
FT                   GSVKCRFKLTEQGEVIFARYGNPVLAIRHVESVAAATLLQSAPSVEKRNTDMTKKYADM
FT                   ASKLDEAAHNRFLDLLNTDGFAPWFSTVTPLTEIGLLPIGSRPAKRGLGAKSLDDLRTI
FT                   PWIFSWAQARINLAAWYGLGTACEQFGDLNTLRQAYEEWPLFSTFIDNIEMSLAKTDER
FT                   IAKMYLALGDREDLNKKVLDEMELTRKWVLKIVGDEWPLQHRHVLGQAIRIRSPYVDAL
FT                   SVTQVLALGSLRKRVDKEELTHGQKENYTYLILCTVSGVAAGLQNTG"
     MTTENEQITP ADAAIVSSGT GTKGPEERDL PASLKEEMDL CLQILREVLG EFDENLLAKF        60
     DEVREHALKA SDERFSGILT DTNPDQDDLQ KVVDIIDKTD VHEAQLLARA FTTYFHLANL       120
     CEENYRVSVL HSRENAVDDT QAVDPVNEMT CAYHQLINEM GPARAKELLD QLEFHPVFTA       180
     HPTEARRKAV EGKIRRISQL LEAHKLLGGS DKKENSRRLF NEIDALFRTS PIALKKPTPV       240
     EEADTILDIF DNTLFYTIPQ VYRRFDDWVL GDKAGLVPPV CPAFFHPGSW IGSDRDGNPN       300
     VTAKVSRQVA RKFSDHVLGA LEIETRRVGK NLTMEAETTP PSAELKSLWN HQKEMSERLT       360
     DKAALISTKE LHRAVMLVMA DRLKATIDRD ADLMYHSCED YIADLKTVQR SLAEANAKRS       420
     AYGPLQDLIW QAETFGFHMV EMEFRQHSVV HSRALEDIRE HGLHGERGEL QPMTHEVLDT       480
     FRALGSIQKR NGIKAARRYI ISFTKSAQNI KDVYELNRLA FSHPEDVPTI DVIPLFEQLE       540
     DLQNSVDVLE EMIKIPEVQA RLKATGGKME VMLGYSDSSK DAGPTSATLA LHSAQERIAK       600
     WAESHDIDLT LFHGRGGAVG RGGGPANRAV LAQPVGSVKC RFKLTEQGEV IFARYGNPVL       660
     AIRHVESVAA ATLLQSAPSV EKRNTDMTKK YADMASKLDE AAHNRFLDLL NTDGFAPWFS       720
     TVTPLTEIGL LPIGSRPAKR GLGAKSLDDL RTIPWIFSWA QARINLAAWY GLGTACEQFG       780
     DLNTLRQAYE EWPLFSTFID NIEMSLAKTD ERIAKMYLAL GDREDLNKKV LDEMELTRKW       840
     VLKIVGDEWP LQHRHVLGQA IRIRSPYVDA LSVTQVLALG SLRKRVDKEE LTHGQKENYT       900
     YLILCTVSGV AAGLQNTG                                                     918
//

If you have problems or comments...

PBIL Back to PBIL home page