(data stored in ACNUC30630 zone)

EMBL: AP009256.PE249

AP009256.PE249       Location/Qualifiers
FT   CDS             complement(323643..324422)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0249"
FT                   /product="hypothetical protein"
FT                   /note="COG family: regulator of polyketide
FT                   synthaseexpression"
FT                   /note="Orthologue of BL1531"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0249"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39030"
FT                   /db_xref="InterPro:IPR025736"
FT                   /db_xref="InterPro:IPR042070"
FT                   /db_xref="PDB:3ONQ"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZZ7"
FT                   /protein_id="BAF39030.1"
FT                   /translation="MNSEQADILDLLSGHTDDTTIERLAFECLLTNMTDDRVVSLMNIL
FT                   GWQGDFNCFAIGGVPSASLASTSLAIRKAVRDLGGEHVVIGTYGTFLLALACQMGAVTP
FT                   EVTCTAVMPAFSEDEPLYLSPVRSGVAGASHALRETMFSLQAAPALSTPSRPLRADELL
FT                   PERALLGDDYAREELYRNVYQVLRGENPDDPTYLTVSTFLKYGSSLENTAKELNVHPNT
FT                   VRYRLKRAAETTGWDATDPRDAYVLTTALAIGRMRDR"
     MNSEQADILD LLSGHTDDTT IERLAFECLL TNMTDDRVVS LMNILGWQGD FNCFAIGGVP        60
     SASLASTSLA IRKAVRDLGG EHVVIGTYGT FLLALACQMG AVTPEVTCTA VMPAFSEDEP       120
     LYLSPVRSGV AGASHALRET MFSLQAAPAL STPSRPLRAD ELLPERALLG DDYAREELYR       180
     NVYQVLRGEN PDDPTYLTVS TFLKYGSSLE NTAKELNVHP NTVRYRLKRA AETTGWDATD       240
     PRDAYVLTTA LAIGRMRDR                                                    259
//

If you have problems or comments...

PBIL Back to PBIL home page