(data stored in ACNUC30630 zone)

EMBL: AP009256.PE251

AP009256.PE251       Location/Qualifiers
FT   CDS             326683..327633
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0251"
FT                   /product="hypothetical protein"
FT                   /note="COG family: biotin-(acetyl-CoA carboxylase) ligase"
FT                   /note="Orthologue of BL1533"
FT                   /note="PFAM_ID: BPL_LipA_LipB"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0251"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39032"
FT                   /db_xref="GOA:A0ZZZ9"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR004408"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZZ9"
FT                   /protein_id="BAF39032.1"
FT                   /translation="MTTILDSALTMPRTCVAADQVIALDSVGSTNTYAAELVRKGALFG
FT                   SARRDGLDGCDGRDWTGREIVAICADEQTAGRGRLDHQWTSAVGESFIVSLVVSVPTAI
FT                   VRDTSVNGWLQMIAGCEARNAIIAAIRDCGGPLGKDIVLKWPNDIFVDGKKLGGVLAEM
FT                   VPLAATPIADGATGTTDVAAATERVGIVFGIGLNLTVPEDHLPTDKATSLQLVAHGLPD
FT                   SMTLRDMIAAHLVDGLRSRLADFEADPHREATRAMEEMRPVCWTLDKPCEAHFVDGTTL
FT                   RGTALELNPDASLTIRDDNGNLHTVHTADVGVLPQ"
     MTTILDSALT MPRTCVAADQ VIALDSVGST NTYAAELVRK GALFGSARRD GLDGCDGRDW        60
     TGREIVAICA DEQTAGRGRL DHQWTSAVGE SFIVSLVVSV PTAIVRDTSV NGWLQMIAGC       120
     EARNAIIAAI RDCGGPLGKD IVLKWPNDIF VDGKKLGGVL AEMVPLAATP IADGATGTTD       180
     VAAATERVGI VFGIGLNLTV PEDHLPTDKA TSLQLVAHGL PDSMTLRDMI AAHLVDGLRS       240
     RLADFEADPH REATRAMEEM RPVCWTLDKP CEAHFVDGTT LRGTALELNP DASLTIRDDN       300
     GNLHTVHTAD VGVLPQ                                                       316
//

If you have problems or comments...

PBIL Back to PBIL home page