(data stored in ACNUC30630 zone)

EMBL: AP009256.PE282

AP009256.PE282       Location/Qualifiers
FT   CDS             373897..374838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0282"
FT                   /product="probable solute binding protein of ABC
FT                   transporter system"
FT                   /note="COG family: ABC-type Mn_Zn transport
FT                   system_periplasmic Mn_Zn-binding (lipo)protein (surface
FT                   adhesina)"
FT                   /note="Orthologue of BL1126"
FT                   /note="PFAM_ID: Lipoprotein_4"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0282"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39063"
FT                   /db_xref="GOA:A1A030"
FT                   /db_xref="InterPro:IPR006127"
FT                   /db_xref="UniProtKB/TrEMBL:A1A030"
FT                   /protein_id="BAF39063.1"
FT                   /translation="MMDSPKHEAYENGGTIVNRYARIAIAVLASVGLLTSASACGTSQN
FT                   GAGSAHGAISVVSSINQWGTLAEQLGGSGVQVTSIINSTNVDAHDYEPTTSDIAKLQKA
FT                   RIVIVNGAGYDSWAVKAAQSAKSQVINAAEIGGVKDGGNPHVWFSAAVRKAVAQAITRA
FT                   YEGTRPDGKADFDKLNQQWRSKEDEVARKITETKRKADGEAYAATESVAEYLAGDLGLK
FT                   DATPTGYMRATANESEPTPTDIKQFTDMLEAGKVGLLVVNIQEETELTGKIVTAAKSSN
FT                   IPIVELTEQMPEQYDSLTDWMAALVDAFSQAI"
     MMDSPKHEAY ENGGTIVNRY ARIAIAVLAS VGLLTSASAC GTSQNGAGSA HGAISVVSSI        60
     NQWGTLAEQL GGSGVQVTSI INSTNVDAHD YEPTTSDIAK LQKARIVIVN GAGYDSWAVK       120
     AAQSAKSQVI NAAEIGGVKD GGNPHVWFSA AVRKAVAQAI TRAYEGTRPD GKADFDKLNQ       180
     QWRSKEDEVA RKITETKRKA DGEAYAATES VAEYLAGDLG LKDATPTGYM RATANESEPT       240
     PTDIKQFTDM LEAGKVGLLV VNIQEETELT GKIVTAAKSS NIPIVELTEQ MPEQYDSLTD       300
     WMAALVDAFS QAI                                                          313
//

If you have problems or comments...

PBIL Back to PBIL home page