(data stored in ACNUC30630 zone)

EMBL: AP009256.PE288

AP009256.PE288       Location/Qualifiers
FT   CDS             complement(383415..384215)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0288"
FT                   /product="hypothetical protein"
FT                   /note="Orthologue of BL1553"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0288"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39069"
FT                   /db_xref="InterPro:IPR013974"
FT                   /db_xref="UniProtKB/TrEMBL:A1A036"
FT                   /protein_id="BAF39069.1"
FT                   /translation="MMTFFHSLMDRRPHSSLRTSTASEGRTARTTRLQRDRHGSTAASL
FT                   EARRSNARLHRFLAALCAGLTVFATLQCVRAAIATQPIVVAVRNVAKGTAITREDVELR
FT                   EAPSDGSLSNAFHTLDDAVGLIAQVGIGAHDVLMSGMARASPVVPQGHTSIEVRLASVA
FT                   GGLIPGDKVTLSSATMTDAEMQSGTPNVADMPNGTETPSGMANDMPDGGVDAQLHTICA
FT                   EALLTGKPAKDAQGNTIAVFAMPPNEAAVVLRVQEYSAVIATIN"
     MMTFFHSLMD RRPHSSLRTS TASEGRTART TRLQRDRHGS TAASLEARRS NARLHRFLAA        60
     LCAGLTVFAT LQCVRAAIAT QPIVVAVRNV AKGTAITRED VELREAPSDG SLSNAFHTLD       120
     DAVGLIAQVG IGAHDVLMSG MARASPVVPQ GHTSIEVRLA SVAGGLIPGD KVTLSSATMT       180
     DAEMQSGTPN VADMPNGTET PSGMANDMPD GGVDAQLHTI CAEALLTGKP AKDAQGNTIA       240
     VFAMPPNEAA VVLRVQEYSA VIATIN                                            266
//

If you have problems or comments...

PBIL Back to PBIL home page