(data stored in ACNUC30630 zone)

EMBL: AP009256.PE291

AP009256.PE291       Location/Qualifiers
FT   CDS             386013..387209
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0291"
FT                   /product="hypothetical protein"
FT                   /note="Orthologue of BL1557"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0291"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39072"
FT                   /db_xref="GOA:A1A039"
FT                   /db_xref="UniProtKB/TrEMBL:A1A039"
FT                   /protein_id="BAF39072.1"
FT                   /translation="MGYESLSTVVVLAIVVILMLIWLPRRTIKGMKRVIEHREDRFSPS
FT                   LHLVDADSGTRFSDETVAAAKGVLMQSTEAHKGATSEERIAEIRALRHAAVRRRRAIAV
FT                   SLLTITVVVLVCAFALHFSPLFALIPAALLAAVLALGVRASKQAVAWERKVARYHAKVK
FT                   KRVAAERKRAQAEQAERARLRAQELAEARKVVDEQLKTDVVPEGEIRQAIARGKADRDA
FT                   AVKRRKEEMSSKEETQTAEKAVDQTTERADAAPADVKEVGLSIHDERDNMAEEAKTVAV
FT                   KSTQDLISFSLGAPRDGADVEVDAPESMEIKSTKQVAKAVPVETPSDEAEPLIPPNDAM
FT                   GSMDADEAAARVDEGVHLREVDVPGFHDAEVRADVEAPDVTSDSLGTGLEAILARRSA"
     MGYESLSTVV VLAIVVILML IWLPRRTIKG MKRVIEHRED RFSPSLHLVD ADSGTRFSDE        60
     TVAAAKGVLM QSTEAHKGAT SEERIAEIRA LRHAAVRRRR AIAVSLLTIT VVVLVCAFAL       120
     HFSPLFALIP AALLAAVLAL GVRASKQAVA WERKVARYHA KVKKRVAAER KRAQAEQAER       180
     ARLRAQELAE ARKVVDEQLK TDVVPEGEIR QAIARGKADR DAAVKRRKEE MSSKEETQTA       240
     EKAVDQTTER ADAAPADVKE VGLSIHDERD NMAEEAKTVA VKSTQDLISF SLGAPRDGAD       300
     VEVDAPESME IKSTKQVAKA VPVETPSDEA EPLIPPNDAM GSMDADEAAA RVDEGVHLRE       360
     VDVPGFHDAE VRADVEAPDV TSDSLGTGLE AILARRSA                               398
//

If you have problems or comments...

PBIL Back to PBIL home page