(data stored in ACNUC30630 zone)

EMBL: AP009256.PE295

AP009256.PE295       Location/Qualifiers
FT   CDS             389726..391270
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0295"
FT                   /product="possible cationic amino acid transporter"
FT                   /note="COG family: amino acid transporters"
FT                   /note="Orthologue of BL1562"
FT                   /note="PFAM_ID:aa_permeases"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0295"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39076"
FT                   /db_xref="GOA:A1A043"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:A1A043"
FT                   /protein_id="BAF39076.1"
FT                   /translation="MERETARAERREGRDMNVFRKKSVEQTLAETGESGHALKRDLTWW
FT                   DLAIMGVAVAVGAGIFSIGAQAAAFHAGPAVVLSFLIAGVVCGAAVMCYAEFASMIPVA
FT                   GSAYTFTYTTVGEIVAWVIGWDLILEMLMAGSVVSKYWGVYLNQFFELIGWNINTNIAI
FT                   GSFNFDLAPVIIVAFFTALLVMGTKIGARVDGALTILKIAIVVFIVVVGFFYIKAENFT
FT                   PFIPPSEPAASTDGSGVSAVMEQPLWQWATGMAPSIYGVTGIISGAALVFFAFLGFDVV
FT                   ATASEETINPKKNVPLGIGVGLGLIIVLYTLVAIVTTGMVSYKDLAKQSDPSLAVAFKM
FT                   VGADWAAKIISLGIVIGMATVVMVLLLGLTRVVFAMSRDGLLPRGLSHTGKHGTPVRLQ
FT                   IIVGVVMALIAACCNVGILSDMVNIGTLSAFTLVAISIPIMRKKRPDLERSFKIPGNPW
FT                   VPILIALANLWLMVNLSVLTWIRFVVWLIVGFAIYFGYGYRHARLGAGELEVAAQE"
     MERETARAER REGRDMNVFR KKSVEQTLAE TGESGHALKR DLTWWDLAIM GVAVAVGAGI        60
     FSIGAQAAAF HAGPAVVLSF LIAGVVCGAA VMCYAEFASM IPVAGSAYTF TYTTVGEIVA       120
     WVIGWDLILE MLMAGSVVSK YWGVYLNQFF ELIGWNINTN IAIGSFNFDL APVIIVAFFT       180
     ALLVMGTKIG ARVDGALTIL KIAIVVFIVV VGFFYIKAEN FTPFIPPSEP AASTDGSGVS       240
     AVMEQPLWQW ATGMAPSIYG VTGIISGAAL VFFAFLGFDV VATASEETIN PKKNVPLGIG       300
     VGLGLIIVLY TLVAIVTTGM VSYKDLAKQS DPSLAVAFKM VGADWAAKII SLGIVIGMAT       360
     VVMVLLLGLT RVVFAMSRDG LLPRGLSHTG KHGTPVRLQI IVGVVMALIA ACCNVGILSD       420
     MVNIGTLSAF TLVAISIPIM RKKRPDLERS FKIPGNPWVP ILIALANLWL MVNLSVLTWI       480
     RFVVWLIVGF AIYFGYGYRH ARLGAGELEV AAQE                                   514
//

If you have problems or comments...

PBIL Back to PBIL home page