(data stored in ACNUC30630 zone)

EMBL: AP009256.PE312

AP009256.PE312       Location/Qualifiers
FT   CDS             complement(411915..412271)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0312"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0312"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39093"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="UniProtKB/TrEMBL:A1A060"
FT                   /protein_id="BAF39093.1"
FT                   /translation="MKNPPLHRYATRPGLYFTDDGGADAVVRSETADQVWFCVLEPLDQ
FT                   PSAFYADAARLFNEPGLTFIDQAKKQRICTRRIPSLNLRETLFRMDGPNYGLWYVHVPQ
FT                   AWDGMQYGYRVNGP"
     MKNPPLHRYA TRPGLYFTDD GGADAVVRSE TADQVWFCVL EPLDQPSAFY ADAARLFNEP        60
     GLTFIDQAKK QRICTRRIPS LNLRETLFRM DGPNYGLWYV HVPQAWDGMQ YGYRVNGP         118
//

If you have problems or comments...

PBIL Back to PBIL home page