(data stored in ACNUC30630 zone)

EMBL: AP009256.PE32

AP009256.PE32        Location/Qualifiers
FT   CDS             41217..42377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0032"
FT                   /product="hypothetical protein"
FT                   /note="Identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0032"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38813"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZD0"
FT                   /protein_id="BAF38813.1"
FT                   /translation="MYRPTTPASKAPKSSAKNFQPLEDLFSMTAPFKVSKHWLTCSFKP
FT                   ALFPILIRGMCRLGGFTRRKIPHVPVVLSYGIPTIQSVSRFPIVQGSVLRPIAAIPVAQ
FT                   RRPGHHHRHHGDLHRGVDHRSGPLPRLARRRQRVRERRHAAARHGRPAPVDLHHLDVPA
FT                   PADLAVAHPVQHAYFVVRGARAGTHDGALAVSCAVPAVRIGRRRRTDGVGRVLAVGMDD
FT                   RRIWRVRRAVRPVRRDSGGVQENRHRYSFDADLDADQLPDAGDHAGHCMAGACRRIHRR
FT                   RRACVAAGHRPACVPRQKPDVAHHGVRHHGVRGGRGDHRGMQRRQSADAYVTSVPVMRE
FT                   LHTCSFPHPWITLWISDVKPVGKSGITWWIIHKDIHKMAEHKEFPM"
     MYRPTTPASK APKSSAKNFQ PLEDLFSMTA PFKVSKHWLT CSFKPALFPI LIRGMCRLGG        60
     FTRRKIPHVP VVLSYGIPTI QSVSRFPIVQ GSVLRPIAAI PVAQRRPGHH HRHHGDLHRG       120
     VDHRSGPLPR LARRRQRVRE RRHAAARHGR PAPVDLHHLD VPAPADLAVA HPVQHAYFVV       180
     RGARAGTHDG ALAVSCAVPA VRIGRRRRTD GVGRVLAVGM DDRRIWRVRR AVRPVRRDSG       240
     GVQENRHRYS FDADLDADQL PDAGDHAGHC MAGACRRIHR RRRACVAAGH RPACVPRQKP       300
     DVAHHGVRHH GVRGGRGDHR GMQRRQSADA YVTSVPVMRE LHTCSFPHPW ITLWISDVKP       360
     VGKSGITWWI IHKDIHKMAE HKEFPM                                            386
//

If you have problems or comments...

PBIL Back to PBIL home page