(data stored in ACNUC30630 zone)

EMBL: AP009256.PE34

AP009256.PE34        Location/Qualifiers
FT   CDS             complement(44105..44572)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0034"
FT                   /product="membrane protein"
FT                   /note="Orthologue of BL0593"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0034"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38815"
FT                   /db_xref="GOA:A0ZZD2"
FT                   /db_xref="InterPro:IPR009619"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZD2"
FT                   /protein_id="BAF38815.1"
FT                   /translation="MLMADEELHETTADDQKDLQSADDTAAVEETTEDVVDKTSVDEDQ
FT                   SDDDDLDIPMDRVEAVLNATVDKDSLSPQMQRMMNRQAENTRRVEESIKGTKSNPRWFV
FT                   PLFCALMIIGLVWAVVYYLTTDYPIPHIGAWNLAIAFAIIMVGFIMTMWWR"
     MLMADEELHE TTADDQKDLQ SADDTAAVEE TTEDVVDKTS VDEDQSDDDD LDIPMDRVEA        60
     VLNATVDKDS LSPQMQRMMN RQAENTRRVE ESIKGTKSNP RWFVPLFCAL MIIGLVWAVV       120
     YYLTTDYPIP HIGAWNLAIA FAIIMVGFIM TMWWR                                  155
//

If you have problems or comments...

PBIL Back to PBIL home page