(data stored in ACNUC30630 zone)

EMBL: AP009256.PE36

AP009256.PE36        Location/Qualifiers
FT   CDS             45494..46588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0036"
FT                   /product="hypothetical protein"
FT                   /note="Orthologue of BL0591"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0036"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38817"
FT                   /db_xref="GOA:A0ZZD4"
FT                   /db_xref="InterPro:IPR005754"
FT                   /db_xref="InterPro:IPR023365"
FT                   /db_xref="InterPro:IPR042003"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZD4"
FT                   /protein_id="BAF38817.1"
FT                   /translation="MKHVASRGGRTKSALWTILGILAELMLTAAAICALYIAWQMWWTG
FT                   VQSEHNQIETRQSVSWSDPGKSGNVTVAKAQQGDPPVQPQSATEGELIAQIYIPRFGSQ
FT                   WQRNLVEGTDLTQLNKHGLGHYTDSQMPGQVGNFAFAGHRNGYGQPLGDVDKLQEGDPI
FT                   IVRTQDYWYVYHYTSYKIVLPTQTEVVAANPENPGATPTKRMLTMTTCEPKYSTPTHRW
FT                   ISYAEFSYWAKVSDGIPQELASQNANGTVKFVNNEQSSFLSSIDTLKPWIFGALAAYVI
FT                   IFISAAVAWRWPYLADVRAGRRKKADFSLYGSLVRLQPGVLPIRLLLVLLLVFAAAASC
FT                   FEWLFPWAASTIPMLQEMSNYTAI"
     MKHVASRGGR TKSALWTILG ILAELMLTAA AICALYIAWQ MWWTGVQSEH NQIETRQSVS        60
     WSDPGKSGNV TVAKAQQGDP PVQPQSATEG ELIAQIYIPR FGSQWQRNLV EGTDLTQLNK       120
     HGLGHYTDSQ MPGQVGNFAF AGHRNGYGQP LGDVDKLQEG DPIIVRTQDY WYVYHYTSYK       180
     IVLPTQTEVV AANPENPGAT PTKRMLTMTT CEPKYSTPTH RWISYAEFSY WAKVSDGIPQ       240
     ELASQNANGT VKFVNNEQSS FLSSIDTLKP WIFGALAAYV IIFISAAVAW RWPYLADVRA       300
     GRRKKADFSL YGSLVRLQPG VLPIRLLLVL LLVFAAAASC FEWLFPWAAS TIPMLQEMSN       360
     YTAI                                                                    364
//

If you have problems or comments...

PBIL Back to PBIL home page