(data stored in ACNUC30630 zone)

EMBL: AP009256.PE363

AP009256.PE363       Location/Qualifiers
FT   CDS             complement(455409..456797)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0363"
FT                   /product="hypothetical protein"
FT                   /note="Orthologue of lin0802"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0363"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39144"
FT                   /db_xref="GOA:A1A0B1"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR032834"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0B1"
FT                   /protein_id="BAF39144.1"
FT                   /translation="MFAPLGEIIRNGIAQTTPSGLFFAIGEQLNALSGLALCLIMAWSH
FT                   MDNPRRNGTLFMSIGLVWFLLCGVLCGTLGIPSLWTVIPTAPLVLLVLRWLTELPWRQL
FT                   LLIVATASYMVAIVYYLSLVIDVAVLGADSTNLRVGWPGLVNLLLLDVIALVSLWHPLH
FT                   DSIPATFDSPSISKGFWQLIWLFPFVSSAIVVWCMPADNSTLLDSHMLEIAFTVAVVYS
FT                   CFMVLAYFLIWYMIQQSDRLLAARRRQHYEALQTLQLQHMNERIREARQIKHNVRHHIH
FT                   SLQALAAAEDMDGIRSYLDEMSKHRLLQPAPMQYCEHASLNAVLVYYCDWVRHLGADVD
FT                   VKAAVPQYININNAELCSMVGNLLENATEAITQQTQGERRLKVRIRYRSGPPAALFITV
FT                   DNTYGEADTSIEQIDGDLVSTKHGGTGLGTATVRETAERHHGTASFEHSDGMFRASVML
FT                   CLGD"
     MFAPLGEIIR NGIAQTTPSG LFFAIGEQLN ALSGLALCLI MAWSHMDNPR RNGTLFMSIG        60
     LVWFLLCGVL CGTLGIPSLW TVIPTAPLVL LVLRWLTELP WRQLLLIVAT ASYMVAIVYY       120
     LSLVIDVAVL GADSTNLRVG WPGLVNLLLL DVIALVSLWH PLHDSIPATF DSPSISKGFW       180
     QLIWLFPFVS SAIVVWCMPA DNSTLLDSHM LEIAFTVAVV YSCFMVLAYF LIWYMIQQSD       240
     RLLAARRRQH YEALQTLQLQ HMNERIREAR QIKHNVRHHI HSLQALAAAE DMDGIRSYLD       300
     EMSKHRLLQP APMQYCEHAS LNAVLVYYCD WVRHLGADVD VKAAVPQYIN INNAELCSMV       360
     GNLLENATEA ITQQTQGERR LKVRIRYRSG PPAALFITVD NTYGEADTSI EQIDGDLVST       420
     KHGGTGLGTA TVRETAERHH GTASFEHSDG MFRASVMLCL GD                          462
//

If you have problems or comments...

PBIL Back to PBIL home page