(data stored in ACNUC30630 zone)

EMBL: AP009256.PE375

AP009256.PE375       Location/Qualifiers
FT   CDS             complement(472876..474030)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0375"
FT                   /product="AraJ-like protein probably involved in transport
FT                   of arabinose polymers"
FT                   /note="COG family: arabinose efflux permease"
FT                   /note="Orthologue of BL1652"
FT                   /note="PFAM_ID:sugar_tr"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0375"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39156"
FT                   /db_xref="GOA:A1A0C3"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0C3"
FT                   /protein_id="BAF39156.1"
FT                   /translation="MKRSILALASGAFILGAAEFVMMGILPQTATAMHVSIPAAGHYIS
FT                   AYAIGVCVGTLILVFGRKVPPKHLIILFMAIALVGNTLSAVSFCSPMLLVARFISGLPH
FT                   GAFFGTATLIAKTLADKGKEAQSVSMMVMGQTVANMLGVPAGTLLAEAMSWRLAFAILA
FT                   AWALMTIVVVISWVPSIDPIKDAGIKGQFRFLTHPGPWLILLAVFFGNSGIFCWWSYVS
FT                   PWLQKTGGWSATMVPMLMVLAGLGMVVGGIVGGRLTDLWKAGATAALSHGIALCGLLLV
FT                   FLLPGNHATTALLTFIIGFALFFNSSPQQLLMVQAGEGGGELIAGAAVQIAFNFGNAIG
FT                   SIVGGAALTATAMNYHFTGIAGAPISLLAVILLVLYTRRYEARA"
     MKRSILALAS GAFILGAAEF VMMGILPQTA TAMHVSIPAA GHYISAYAIG VCVGTLILVF        60
     GRKVPPKHLI ILFMAIALVG NTLSAVSFCS PMLLVARFIS GLPHGAFFGT ATLIAKTLAD       120
     KGKEAQSVSM MVMGQTVANM LGVPAGTLLA EAMSWRLAFA ILAAWALMTI VVVISWVPSI       180
     DPIKDAGIKG QFRFLTHPGP WLILLAVFFG NSGIFCWWSY VSPWLQKTGG WSATMVPMLM       240
     VLAGLGMVVG GIVGGRLTDL WKAGATAALS HGIALCGLLL VFLLPGNHAT TALLTFIIGF       300
     ALFFNSSPQQ LLMVQAGEGG GELIAGAAVQ IAFNFGNAIG SIVGGAALTA TAMNYHFTGI       360
     AGAPISLLAV ILLVLYTRRY EARA                                              384
//

If you have problems or comments...

PBIL Back to PBIL home page