(data stored in ACNUC30630 zone)

EMBL: AP009256.PE379

AP009256.PE379       Location/Qualifiers
FT   CDS             complement(478362..480308)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0379"
FT                   /product="myosin-crossreactive antigen"
FT                   /note="Orthologue of LBA0649"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0379"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39160"
FT                   /db_xref="GOA:A1A0C7"
FT                   /db_xref="InterPro:IPR010354"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0C7"
FT                   /protein_id="BAF39160.1"
FT                   /translation="MPVYLCPTTRHNSAQRHPKEEVMYYSNGNYEAFARPRKPEGIDDK
FT                   NAYIIGTGLAALSAACYLVRDAQMPGDHIHVFEKDPVPGGACDGANIPGVGYVMRGGRE
FT                   MDNHFEVMWDLFRSIPSIETDGVSVLDEYYWLNKDDPNYSLCRSTKARGVDGGTNGKFA
FT                   LSDKASMEIMELFFTPNEELYGKKISDFFDDEVFDTNFWMYWRTMFAFENWHSALEMKL
FT                   YIRRYIHHIGGLPDFSALRFTRYNQYESMILPMIKYLEGFGVQFHYNVKVENVDFAIGG
FT                   GMGPVRQRTGTGQDTILRKQAEYGAYPRNPFSSPTKKMATRIDLTKADGTTRSIDLGEN
FT                   DLVFITNGGCVENSSMGSQTEPAAWAPEIKPGGGWDMWRRIAAQDPSFGHPDVFCSDPE
FT                   HSKWMSATVTTLDGEIPPYIQKICKRDPFSGRVVTGGIVTVEDSNWLMSWTLNRQQQFR
FT                   DQPKDQLCVWVYGLFPDKPGNYVKKPMQDCTGEEICEEWLYHMGVPTDKIADLAKNHAN
FT                   TVPVMMPYIDAFFMPRSAGDRPDVVPDGAVNFAFLGQFAETPRDTIFTTEYSMRTGMEA
FT                   VYTLCDVDRGVPEVWGSVYDVRNLLNATVMLRDGKPITDMKLNPIERGVLKQIVKKLDS
FT                   TDIPTLLKEYGVI"
     MPVYLCPTTR HNSAQRHPKE EVMYYSNGNY EAFARPRKPE GIDDKNAYII GTGLAALSAA        60
     CYLVRDAQMP GDHIHVFEKD PVPGGACDGA NIPGVGYVMR GGREMDNHFE VMWDLFRSIP       120
     SIETDGVSVL DEYYWLNKDD PNYSLCRSTK ARGVDGGTNG KFALSDKASM EIMELFFTPN       180
     EELYGKKISD FFDDEVFDTN FWMYWRTMFA FENWHSALEM KLYIRRYIHH IGGLPDFSAL       240
     RFTRYNQYES MILPMIKYLE GFGVQFHYNV KVENVDFAIG GGMGPVRQRT GTGQDTILRK       300
     QAEYGAYPRN PFSSPTKKMA TRIDLTKADG TTRSIDLGEN DLVFITNGGC VENSSMGSQT       360
     EPAAWAPEIK PGGGWDMWRR IAAQDPSFGH PDVFCSDPEH SKWMSATVTT LDGEIPPYIQ       420
     KICKRDPFSG RVVTGGIVTV EDSNWLMSWT LNRQQQFRDQ PKDQLCVWVY GLFPDKPGNY       480
     VKKPMQDCTG EEICEEWLYH MGVPTDKIAD LAKNHANTVP VMMPYIDAFF MPRSAGDRPD       540
     VVPDGAVNFA FLGQFAETPR DTIFTTEYSM RTGMEAVYTL CDVDRGVPEV WGSVYDVRNL       600
     LNATVMLRDG KPITDMKLNP IERGVLKQIV KKLDSTDIPT LLKEYGVI                    648
//

If you have problems or comments...

PBIL Back to PBIL home page