(data stored in ACNUC30630 zone)

EMBL: AP009256.PE381

AP009256.PE381       Location/Qualifiers
FT   CDS             481357..482616
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0381"
FT                   /product="sensor protein"
FT                   /note="COG family: sensory transduction histidine kinases"
FT                   /note="Orthologue of BL1658"
FT                   /note="PFAM_ID: HATPase_c"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0381"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39162"
FT                   /db_xref="GOA:A1A0C9"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0C9"
FT                   /protein_id="BAF39162.1"
FT                   /translation="MFTGTFTLRSRKSRHDHSSGNVRVCENEDMFESVGTWWRNLTHRH
FT                   GDDRNNDDTLDDATNTLLSILPLASIVVDEHDEVIRAHPDAYALGVVRDDAIADDTVAS
FT                   AVHEVRAHGGKKQFSLTTTTLHEPKKAPKAGKPTMREVAKQALIGQSPDKPVTTVSRPN
FT                   WLKVIVGRLNERFVVVLVSDVSETVRFSQIRDSFITNVSEQLLKPTQSLEELADALEHD
FT                   SDNKAAIEGNTVKLRQSCARMEHMVSDLLLLIKAQEPILPTASNRINVMEQVKTVVDAH
FT                   RDMAQRRGIDIEIDGDESLDINGEGEQIQAAVAKLLENAIAYSPDGKGITVSVKPNEDG
FT                   TKVLLSVLDRGCGIAQKEQSRIFERFYRGGNQNGHSEEGIGLGLAIVKHVALTHHGSAS
FT                   VWSAPGQGSTFTLGLPVARN"
     MFTGTFTLRS RKSRHDHSSG NVRVCENEDM FESVGTWWRN LTHRHGDDRN NDDTLDDATN        60
     TLLSILPLAS IVVDEHDEVI RAHPDAYALG VVRDDAIADD TVASAVHEVR AHGGKKQFSL       120
     TTTTLHEPKK APKAGKPTMR EVAKQALIGQ SPDKPVTTVS RPNWLKVIVG RLNERFVVVL       180
     VSDVSETVRF SQIRDSFITN VSEQLLKPTQ SLEELADALE HDSDNKAAIE GNTVKLRQSC       240
     ARMEHMVSDL LLLIKAQEPI LPTASNRINV MEQVKTVVDA HRDMAQRRGI DIEIDGDESL       300
     DINGEGEQIQ AAVAKLLENA IAYSPDGKGI TVSVKPNEDG TKVLLSVLDR GCGIAQKEQS       360
     RIFERFYRGG NQNGHSEEGI GLGLAIVKHV ALTHHGSASV WSAPGQGSTF TLGLPVARN        419
//

If you have problems or comments...

PBIL Back to PBIL home page