(data stored in ACNUC30630 zone)

EMBL: AP009256.PE385

AP009256.PE385       Location/Qualifiers
FT   CDS             485362..486111
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0385"
FT                   /product="hypothetical protein"
FT                   /note="COG family: cell wall-associated
FT                   hydrolases(invasion-associated proteins)"
FT                   /note="Orthologue of BL1663"
FT                   /note="PFAM_ID: NLPC_P60"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0385"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39166"
FT                   /db_xref="InterPro:IPR000064"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0D3"
FT                   /protein_id="BAF39166.1"
FT                   /translation="MKHIKHCSVIAALAAAALTFAGVAPAALAANDGATQDAVVATRSF
FT                   PKTNAVKKNILAEASSTQVESDSDWGGVESLNVPQTKSQAEKDAEAAAAAAEQQRQQQA
FT                   QAQAQAQAASRSAARSDLSSSGSFTVTPPDGASVSSLLTFANQFVGKVPYVSGGNTPSG
FT                   WDCSGFVQYVYGQMGVSLPHYSGAQATVGRAVGSLADAQPGDIIANAQHAAIYVGNGMV
FT                   INSQLNGTRYDPIAWVFPSSYSIRRIF"
     MKHIKHCSVI AALAAAALTF AGVAPAALAA NDGATQDAVV ATRSFPKTNA VKKNILAEAS        60
     STQVESDSDW GGVESLNVPQ TKSQAEKDAE AAAAAAEQQR QQQAQAQAQA QAASRSAARS       120
     DLSSSGSFTV TPPDGASVSS LLTFANQFVG KVPYVSGGNT PSGWDCSGFV QYVYGQMGVS       180
     LPHYSGAQAT VGRAVGSLAD AQPGDIIANA QHAAIYVGNG MVINSQLNGT RYDPIAWVFP       240
     SSYSIRRIF                                                               249
//

If you have problems or comments...

PBIL Back to PBIL home page