(data stored in ACNUC30630 zone)

EMBL: AP009256.PE397

AP009256.PE397       Location/Qualifiers
FT   CDS             499957..501435
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0397"
FT                   /product="hypothetical protein"
FT                   /note="Orthologue of CAC0735"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0397"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39178"
FT                   /db_xref="GOA:A1A0E5"
FT                   /db_xref="InterPro:IPR031617"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0E5"
FT                   /protein_id="BAF39178.1"
FT                   /translation="MAGIGFELKKLFHRKGLVAMVRAYGYAGVICTGPMLLGILLQFGV
FT                   LAVSGWWHVPRADQNLLVCMITYTLLASLVLTSFLSMPVTRFLADMLFEHHEETILPSF
FT                   WGSTTLMLAVGAVLYAVFLLFSGATLMQGLLCLWLFLEMIVNWNAMSYLTAIKDYQGIM
FT                   WSFVAAVVVAFLSACAMMALGLPQVESLLAAVAFGYGVMMVWDVVLLHRYFPQSSESPW
FT                   TFLAWLDRFLPLALTGLLTTLGLFSHLVITWCGPLGVHVKGLFYGAPYYDVPALLAFLT
FT                   ILITTVNFVVSVEVNFYPKYRAYYALLNDGGTVKDIVVAEREMLAVLNRELYYTALKQL
FT                   FVTAAVISLEKMVLGVLPLGFNDGMHGYFRVLCVGYALYAVGNTMLMILLYFTDYFGAV
FT                   CCAAIFAGSATVLTVISQFVPVTLMGFGFLLGASAFLLAAVVRLAVFTDNLPYRVLGAQ
FT                   PIVATEKRGWFTKLGEALDEFGERLHGTFGRKES"
     MAGIGFELKK LFHRKGLVAM VRAYGYAGVI CTGPMLLGIL LQFGVLAVSG WWHVPRADQN        60
     LLVCMITYTL LASLVLTSFL SMPVTRFLAD MLFEHHEETI LPSFWGSTTL MLAVGAVLYA       120
     VFLLFSGATL MQGLLCLWLF LEMIVNWNAM SYLTAIKDYQ GIMWSFVAAV VVAFLSACAM       180
     MALGLPQVES LLAAVAFGYG VMMVWDVVLL HRYFPQSSES PWTFLAWLDR FLPLALTGLL       240
     TTLGLFSHLV ITWCGPLGVH VKGLFYGAPY YDVPALLAFL TILITTVNFV VSVEVNFYPK       300
     YRAYYALLND GGTVKDIVVA EREMLAVLNR ELYYTALKQL FVTAAVISLE KMVLGVLPLG       360
     FNDGMHGYFR VLCVGYALYA VGNTMLMILL YFTDYFGAVC CAAIFAGSAT VLTVISQFVP       420
     VTLMGFGFLL GASAFLLAAV VRLAVFTDNL PYRVLGAQPI VATEKRGWFT KLGEALDEFG       480
     ERLHGTFGRK ES                                                           492
//

If you have problems or comments...

PBIL Back to PBIL home page