(data stored in ACNUC30630 zone)

EMBL: AP009256.PE420

AP009256.PE420       Location/Qualifiers
FT   CDS             527106..528032
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0420"
FT                   /product="hypothetical protein"
FT                   /note="Orthologue of BL0019"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0420"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39201"
FT                   /db_xref="InterPro:IPR007569"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0G8"
FT                   /protein_id="BAF39201.1"
FT                   /translation="MDNGAQYSESLARLRTRTIEQCLEAQRRTGRRLVFALDTALSLQG
FT                   IELPRYRRGGLLADTLHAVIESNGVRTILQGICFVLWSGPQTHMPIHHGRLRCTDSVTT
FT                   WAMHANRLEDEELVVLGDSMMRRDGHMKKATLEEFRIYVDSLSDLSNYSGSDRLRAVRG
FT                   VSKMRRALRLMRENTDSSQETRSRIVLLCYGLPCPEVNYAIRLKGYSHVFFADMAYPDL
FT                   KIIIEYDGRHHASRWLADSKRREALEDEGWLYIQVTAENLRDEDSQRELAERVAQRMSL
FT                   RLGEPVRLCGRMTIAQIADGRRKGNRL"
     MDNGAQYSES LARLRTRTIE QCLEAQRRTG RRLVFALDTA LSLQGIELPR YRRGGLLADT        60
     LHAVIESNGV RTILQGICFV LWSGPQTHMP IHHGRLRCTD SVTTWAMHAN RLEDEELVVL       120
     GDSMMRRDGH MKKATLEEFR IYVDSLSDLS NYSGSDRLRA VRGVSKMRRA LRLMRENTDS       180
     SQETRSRIVL LCYGLPCPEV NYAIRLKGYS HVFFADMAYP DLKIIIEYDG RHHASRWLAD       240
     SKRREALEDE GWLYIQVTAE NLRDEDSQRE LAERVAQRMS LRLGEPVRLC GRMTIAQIAD       300
     GRRKGNRL                                                                308
//

If you have problems or comments...

PBIL Back to PBIL home page