(data stored in ACNUC30630 zone)

EMBL: AP009256.PE425

AP009256.PE425       Location/Qualifiers
FT   CDS             534698..535993
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0425"
FT                   /product="putative sugar transporter solute-binding
FT                   protein"
FT                   /note="Orthologue of SAV4979"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0425"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39206"
FT                   /db_xref="GOA:A1A0H3"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0H3"
FT                   /protein_id="BAF39206.1"
FT                   /translation="MVNKEKTMKFRTIAAATLAVATMLGMGACGSSTGAKDDKTITFWH
FT                   NATAGDGKQYWEDMAKAFEKKTGVKVQIQAIQNEDFEGKLTTAMQDPASGPDVYMTLGG
FT                   AKTKDMIDAGQTMDLTDKISDTVKKQMSSALESMSYDGKVYGVPVTVQPGGIWYSKDLF
FT                   KQAGIDAAPTTFSELKTDVQKLRSAGIDPIALGGKDAWPVGHWYYWLSMRECSPKAYAK
FT                   GVNDKDFSDSCWTKAGDDLKDLLDANAFNEGFLTTTAQQGASSSAGLLANHKAAMELMG
FT                   TWEPGVLKDLTPDKKPMADLGFFAFPTVDGGKGEEGALMGAVTGFAVNPEAPDAAVDFV
FT                   NFMAEKSNQEKYATAFSTIPASAEAYDAVTDENLKAIIEAMKKSDGMQLWMDTALGGNI
FT                   GNALNSGVVNLLSGQGTSADIVKAMKDAAAKG"
     MVNKEKTMKF RTIAAATLAV ATMLGMGACG SSTGAKDDKT ITFWHNATAG DGKQYWEDMA        60
     KAFEKKTGVK VQIQAIQNED FEGKLTTAMQ DPASGPDVYM TLGGAKTKDM IDAGQTMDLT       120
     DKISDTVKKQ MSSALESMSY DGKVYGVPVT VQPGGIWYSK DLFKQAGIDA APTTFSELKT       180
     DVQKLRSAGI DPIALGGKDA WPVGHWYYWL SMRECSPKAY AKGVNDKDFS DSCWTKAGDD       240
     LKDLLDANAF NEGFLTTTAQ QGASSSAGLL ANHKAAMELM GTWEPGVLKD LTPDKKPMAD       300
     LGFFAFPTVD GGKGEEGALM GAVTGFAVNP EAPDAAVDFV NFMAEKSNQE KYATAFSTIP       360
     ASAEAYDAVT DENLKAIIEA MKKSDGMQLW MDTALGGNIG NALNSGVVNL LSGQGTSADI       420
     VKAMKDAAAK G                                                            431
//

If you have problems or comments...

PBIL Back to PBIL home page