(data stored in ACNUC30630 zone)

EMBL: AP009256.PE43

AP009256.PE43        Location/Qualifiers
FT   CDS             complement(55089..55604)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0043"
FT                   /product="hypothetical protein"
FT                   /note="COG family: FHA-domain-containing proteins"
FT                   /note="Orthologue of BL0584"
FT                   /note="PFAM_ID: FHA"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0043"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38824"
FT                   /db_xref="GOA:A0ZZE1"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZE1"
FT                   /protein_id="BAF38824.1"
FT                   /translation="MLTELTFAILKYGFLVLLWIFVACTVRSLYRDIETLSPRKSRAHR
FT                   RKERAARKAVESPAPVAAAAPSASAATNAKPTLLVIIDGPLAGSSVPLAGNTITLGRSA
FT                   SNTVVLDDEFVSSHHARVYTDPATGRWAIEDLGSTNGTVVNHQRLNAPMILGARVPVRI
FT                   GATTFELR"
     MLTELTFAIL KYGFLVLLWI FVACTVRSLY RDIETLSPRK SRAHRRKERA ARKAVESPAP        60
     VAAAAPSASA ATNAKPTLLV IIDGPLAGSS VPLAGNTITL GRSASNTVVL DDEFVSSHHA       120
     RVYTDPATGR WAIEDLGSTN GTVVNHQRLN APMILGARVP VRIGATTFEL R                171
//

If you have problems or comments...

PBIL Back to PBIL home page