(data stored in ACNUC30630 zone)

EMBL: AP009256.PE439

AP009256.PE439       Location/Qualifiers
FT   CDS             complement(552313..552897)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0439"
FT                   /product="cellobiose-phosphorylase"
FT                   /note="Orthologue of TM1848"
FT                   /note="Similar to GP:3184120 percent identity:
FT                   97.66;identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0439"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39220"
FT                   /db_xref="GOA:A1A0I7"
FT                   /db_xref="InterPro:IPR009342"
FT                   /db_xref="InterPro:IPR010383"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR037018"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0I7"
FT                   /protein_id="BAF39220.1"
FT                   /translation="MRYGHFDDAAKEYVIETPATPLPWINYLGNEDFFSLISNTGGGYS
FT                   FYKDAKLRRITRYRYNNVPADNGSRCYYLSLMDSDSADAKPVETWSPTFLPCKTPLDSC
FT                   KCRQGIGYTVFEASKRGIESKLTAFVPLHTNAEINRLDVTNTTDEPAVIDVTGSVEWCL
FT                   WNAVDDSSNFQRNLSTGEVEIGLATVCWTVS"
     MRYGHFDDAA KEYVIETPAT PLPWINYLGN EDFFSLISNT GGGYSFYKDA KLRRITRYRY        60
     NNVPADNGSR CYYLSLMDSD SADAKPVETW SPTFLPCKTP LDSCKCRQGI GYTVFEASKR       120
     GIESKLTAFV PLHTNAEINR LDVTNTTDEP AVIDVTGSVE WCLWNAVDDS SNFQRNLSTG       180
     EVEIGLATVC WTVS                                                         194
//

If you have problems or comments...

PBIL Back to PBIL home page