(data stored in ACNUC30630 zone)

EMBL: AP009256.PE442

AP009256.PE442       Location/Qualifiers
FT   CDS             554843..555763
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0442"
FT                   /product="possible methylase protein"
FT                   /note="COG family: predicted rRNA or tRNA methylase"
FT                   /note="Orthologue of BL1713"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0442"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39223"
FT                   /db_xref="GOA:A1A0J0"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR004556"
FT                   /db_xref="InterPro:IPR019874"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR040758"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0J0"
FT                   /protein_id="BAF39223.1"
FT                   /translation="MATVFETVRSAADELRAAGVDTPQHDAKLLLAEAFHTDLQHVDKA
FT                   MLMGDGVERLAEKEDAEPAMERFQTMLARRVKREPLQHITGHAPFRYLDLKVGPGVFIP
FT                   RPETELVVQEGVDWATRNGMYRAKVVDLCAGSGAIGLAFASEVPGSEVWAVEKSATTAE
FT                   WTWRNLDETAKRYPAIAGNYHLDIADATQMPTLSQLDGTIDIVLTNPPYVPLADIPEQS
FT                   EVRDYDPDLALYGGSADGTLIPERIIARAAKLLRAGGLMVMEHDITQGERLAAFARTCG
FT                   FVDVTVHNDYTGRPRYLTAEKQPAQ"
     MATVFETVRS AADELRAAGV DTPQHDAKLL LAEAFHTDLQ HVDKAMLMGD GVERLAEKED        60
     AEPAMERFQT MLARRVKREP LQHITGHAPF RYLDLKVGPG VFIPRPETEL VVQEGVDWAT       120
     RNGMYRAKVV DLCAGSGAIG LAFASEVPGS EVWAVEKSAT TAEWTWRNLD ETAKRYPAIA       180
     GNYHLDIADA TQMPTLSQLD GTIDIVLTNP PYVPLADIPE QSEVRDYDPD LALYGGSADG       240
     TLIPERIIAR AAKLLRAGGL MVMEHDITQG ERLAAFARTC GFVDVTVHND YTGRPRYLTA       300
     EKQPAQ                                                                  306
//

If you have problems or comments...

PBIL Back to PBIL home page