(data stored in ACNUC30630 zone)

EMBL: AP009256.PE445

AP009256.PE445       Location/Qualifiers
FT   CDS             558311..559432
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0445"
FT                   /product="permease of ABC transporter for branched-chain
FT                   amino acids"
FT                   /note="COG family: branched-chain amino acid
FT                   ABC-typetransport system_ permease components"
FT                   /note="Orthologue of BL1716"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0445"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39226"
FT                   /db_xref="GOA:A1A0J3"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0J3"
FT                   /protein_id="BAF39226.1"
FT                   /translation="MKKSMLSTKQSYLMCAVGIVVLFGILMGVCESGMASTYIKGIMMT
FT                   SCIAIIMTTSLNLTIGVLGQLTLGCCGFEAIGAYSAALLSKLLVANGVAMDPTLRFLLT
FT                   TLAGGVVACIFGILVGIPALRLHGDYLAIITLGFGEIIRVIIQNLKVAGGMGLDKGAAG
FT                   QALIGIDRLANLYVVFWITVVTVVLLFMFARSRYGRAVKAIRDDEIAASASGINITYMK
FT                   VLVFAISAFFAGIAGGIFAQYIGSLNPAMAGWLQSINYVIMVVFGGMGSLTGSIVSAIA
FT                   LTILPELLRAFSTYRMLVYSVALVLIMIFRPQGIFGNWEFSLTKTINKLFYPMKVKAHG
FT                   KSKQAESTAKAAKDTAKTDETVETAADTKEAQA"
     MKKSMLSTKQ SYLMCAVGIV VLFGILMGVC ESGMASTYIK GIMMTSCIAI IMTTSLNLTI        60
     GVLGQLTLGC CGFEAIGAYS AALLSKLLVA NGVAMDPTLR FLLTTLAGGV VACIFGILVG       120
     IPALRLHGDY LAIITLGFGE IIRVIIQNLK VAGGMGLDKG AAGQALIGID RLANLYVVFW       180
     ITVVTVVLLF MFARSRYGRA VKAIRDDEIA ASASGINITY MKVLVFAISA FFAGIAGGIF       240
     AQYIGSLNPA MAGWLQSINY VIMVVFGGMG SLTGSIVSAI ALTILPELLR AFSTYRMLVY       300
     SVALVLIMIF RPQGIFGNWE FSLTKTINKL FYPMKVKAHG KSKQAESTAK AAKDTAKTDE       360
     TVETAADTKE AQA                                                          373
//

If you have problems or comments...

PBIL Back to PBIL home page