(data stored in ACNUC30630 zone)

EMBL: AP009256.PE447

AP009256.PE447       Location/Qualifiers
FT   CDS             560241..560945
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0447"
FT                   /product="ATP binding protein of ABC transporter for
FT                   branched-chain amino acids"
FT                   /note="COG family: ABC-type branched-chain amino
FT                   acidtransport systems_ ATPase component"
FT                   /note="Orthologue of BL1718"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0447"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39228"
FT                   /db_xref="GOA:A1A0J5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030660"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0J5"
FT                   /protein_id="BAF39228.1"
FT                   /translation="MLEVKNLSVSYGAIEAVKDISFTVNDGEIVSLIGANGAGKTTTLH
FT                   TITGLVPAKSGSVMYNGVDLLKTHNNKIVTLGMAHIPEGRHVFTRMSVEENLEMGAFSL
FT                   KDQSDLKKDLDMVYGLFPRLKERRNQKAGTLSGGEQQMLAMGRALMSHPKTILMDEPSM
FT                   GLSPKLVKEIFSIIRKLHEQGITILLVEQNAKMALSIADRAYVLETGRITMEGDAKELL
FT                   NNEQVRKAYLGA"
     MLEVKNLSVS YGAIEAVKDI SFTVNDGEIV SLIGANGAGK TTTLHTITGL VPAKSGSVMY        60
     NGVDLLKTHN NKIVTLGMAH IPEGRHVFTR MSVEENLEMG AFSLKDQSDL KKDLDMVYGL       120
     FPRLKERRNQ KAGTLSGGEQ QMLAMGRALM SHPKTILMDE PSMGLSPKLV KEIFSIIRKL       180
     HEQGITILLV EQNAKMALSI ADRAYVLETG RITMEGDAKE LLNNEQVRKA YLGA             234
//

If you have problems or comments...

PBIL Back to PBIL home page