(data stored in ACNUC30630 zone)

EMBL: AP009256.PE46

AP009256.PE46        Location/Qualifiers
FT   CDS             complement(59226..60515)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0046"
FT                   /product="hypothetical protein"
FT                   /note="Orthologue of CE2341"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0046"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38827"
FT                   /db_xref="GOA:A0ZZE4"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZE4"
FT                   /protein_id="BAF38827.1"
FT                   /translation="MHAEPTKPRPVSAFRSWHNHMRADHPKLWHPIRITIVVITVWWIL
FT                   FCLVLAPTDNPAAIVWTIIEIAVLLLSPFFPKSMSLLFLIMSQSGPWLIPGADVNSLPG
FT                   ILYTFGMLAYETNNLVALLLLAYSIGDQLFRQLVLGTSRSNPVAIIAMVSLVLMLGCGL
FT                   RWNQAVAGSRAEAEQAKARLREMESRSHIAEAIHDAVTGDLSAAAFVAQRRIDALSGGG
FT                   DGDGSASTDGDDGKNADERRDELDKWTQVNDYILSALTNVHRVIDELDMDVTVLEEDAD
FT                   GKAFSDLLKATMAGGDRRLRALGFDITSILHVAGGAPSASPSLAGIANDLLRETYANIA
FT                   RHAQSGSKADLSVILKPNAVEITQINQARTTETDRTQPGGHGLAYFSKQLESHGGKLET
FT                   TLRDGEWTLFAYLPIPVPETLPPLAGHPES"
     MHAEPTKPRP VSAFRSWHNH MRADHPKLWH PIRITIVVIT VWWILFCLVL APTDNPAAIV        60
     WTIIEIAVLL LSPFFPKSMS LLFLIMSQSG PWLIPGADVN SLPGILYTFG MLAYETNNLV       120
     ALLLLAYSIG DQLFRQLVLG TSRSNPVAII AMVSLVLMLG CGLRWNQAVA GSRAEAEQAK       180
     ARLREMESRS HIAEAIHDAV TGDLSAAAFV AQRRIDALSG GGDGDGSAST DGDDGKNADE       240
     RRDELDKWTQ VNDYILSALT NVHRVIDELD MDVTVLEEDA DGKAFSDLLK ATMAGGDRRL       300
     RALGFDITSI LHVAGGAPSA SPSLAGIAND LLRETYANIA RHAQSGSKAD LSVILKPNAV       360
     EITQINQART TETDRTQPGG HGLAYFSKQL ESHGGKLETT LRDGEWTLFA YLPIPVPETL       420
     PPLAGHPES                                                               429
//

If you have problems or comments...

PBIL Back to PBIL home page