(data stored in ACNUC30630 zone)

EMBL: AP009256.PE461

AP009256.PE461       Location/Qualifiers
FT   CDS             579167..580159
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0461"
FT                   /product="hypothetical protein"
FT                   /note="COG family: tetrahydrodipicolinateN-
FT                   succinyltransferase"
FT                   /note="Orthologue of BL1734"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0461"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39242"
FT                   /db_xref="GOA:A1A0K9"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR019875"
FT                   /db_xref="InterPro:IPR026586"
FT                   /db_xref="InterPro:IPR032784"
FT                   /db_xref="InterPro:IPR038361"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0K9"
FT                   /protein_id="BAF39242.1"
FT                   /translation="MTEQRTAWGWGLASIDAAGNTLDVWYPELTLGEAPAETSRPNHNF
FT                   GAIAHDEADARGVRRMPVFTVSKLDEPIEDAADAYLRLHLLSMRLAKPNTLNLDGIFAK
FT                   LNNVVWTNYGPFAVDDFALRKLDVMAATRQSGAVLAPHVDVNVLSIDKFPRMVDYVVPT
FT                   GVRIGDADRVRLGAHLSEGTTVMHAGFVNFNAGTLGVSMVEGRVSQGVVVGNGSDIGGG
FT                   ASIMGTLSGGGKLKNSIGEHSLLGANAGIGISLGDNCVVEAGLYVTAGTKVTIYDKAKV
FT                   AAGEPLETVKGAELSGKDNILFIRNSVSGRIEARYRKTGIELNEKLHKN"
     MTEQRTAWGW GLASIDAAGN TLDVWYPELT LGEAPAETSR PNHNFGAIAH DEADARGVRR        60
     MPVFTVSKLD EPIEDAADAY LRLHLLSMRL AKPNTLNLDG IFAKLNNVVW TNYGPFAVDD       120
     FALRKLDVMA ATRQSGAVLA PHVDVNVLSI DKFPRMVDYV VPTGVRIGDA DRVRLGAHLS       180
     EGTTVMHAGF VNFNAGTLGV SMVEGRVSQG VVVGNGSDIG GGASIMGTLS GGGKLKNSIG       240
     EHSLLGANAG IGISLGDNCV VEAGLYVTAG TKVTIYDKAK VAAGEPLETV KGAELSGKDN       300
     ILFIRNSVSG RIEARYRKTG IELNEKLHKN                                        330
//

If you have problems or comments...

PBIL Back to PBIL home page