(data stored in ACNUC30630 zone)

EMBL: AP009256.PE493

AP009256.PE493       Location/Qualifiers
FT   CDS             616124..616609
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0493"
FT                   /product="autoinducer-2 production protein LuxS"
FT                   /note="Catalyzes the hydrolyses of S-ribosylhomocysteineto
FT                   homocysteine and autoinducer-2"
FT                   /note="Orthologue of BL1152"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0493"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39274"
FT                   /db_xref="GOA:A1A0P1"
FT                   /db_xref="InterPro:IPR003815"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR037005"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1A0P1"
FT                   /protein_id="BAF39274.1"
FT                   /translation="MAEDKPVVESFQLDHTKVKAPYVRYIDTETGLHGDVISNYDLRLV
FT                   QPNENAIPTGGLHTIEHTIAVLLRERIPGYIDCSPFGCRTGFHLLTWGEHSTEDVARAL
FT                   KESLEFIAYEATWDDVPATTIESCGNYRDHSLFTAKEWCKDILAKGISSDPFERRLV"
     MAEDKPVVES FQLDHTKVKA PYVRYIDTET GLHGDVISNY DLRLVQPNEN AIPTGGLHTI        60
     EHTIAVLLRE RIPGYIDCSP FGCRTGFHLL TWGEHSTEDV ARALKESLEF IAYEATWDDV       120
     PATTIESCGN YRDHSLFTAK EWCKDILAKG ISSDPFERRL V                           161
//

If you have problems or comments...

PBIL Back to PBIL home page