(data stored in ACNUC30630 zone)

EMBL: AP009256.PE502

AP009256.PE502       Location/Qualifiers
FT   CDS             complement(629116..629853)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0502"
FT                   /product="hypothetical protein"
FT                   /note="COG family: histone acetyltransferase Hpa2
FT                   andrelated acetyltransferases"
FT                   /note="Orthologue of BL0130"
FT                   /note="PFAM_ID: Acetyltransf"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0502"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39283"
FT                   /db_xref="GOA:A1A0Q0"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0Q0"
FT                   /protein_id="BAF39283.1"
FT                   /translation="MLADCAVGAYRNVKIGYALRESMHMLIRHATMEDLDAIEAVEAAC
FT                   FPPAEAASNESLTARVAAYPDHFWLLVNTDDDDTPFPSRVEDGTLVGFVDGMATNEPNL
FT                   ADAMYDDADMHDEHGDWQMIFGVDVAPVYQHRGCASYLLRQVILDTAQAGRKGLVLTCK
FT                   ERLVDFYARLGFVDEGLSESTHGNVVWHQMRLALTHAVGTGNPTANGSAKTAERTNDAD
FT                   TTAMSGVDHDTETLEFPQVEPTA"
     MLADCAVGAY RNVKIGYALR ESMHMLIRHA TMEDLDAIEA VEAACFPPAE AASNESLTAR        60
     VAAYPDHFWL LVNTDDDDTP FPSRVEDGTL VGFVDGMATN EPNLADAMYD DADMHDEHGD       120
     WQMIFGVDVA PVYQHRGCAS YLLRQVILDT AQAGRKGLVL TCKERLVDFY ARLGFVDEGL       180
     SESTHGNVVW HQMRLALTHA VGTGNPTANG SAKTAERTND ADTTAMSGVD HDTETLEFPQ       240
     VEPTA                                                                   245
//

If you have problems or comments...

PBIL Back to PBIL home page