(data stored in ACNUC30630 zone)

EMBL: AP009256.PE506

AP009256.PE506       Location/Qualifiers
FT   CDS             632264..633169
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0506"
FT                   /product="probable solute-binding protein for
FT                   glutamate_aspartate ABC transporter system"
FT                   /note="COG family: ABC-type amino acid transport
FT                   system_periplasmic component"
FT                   /note="Orthologue of BL0077"
FT                   /note="PFAM_ID: SBP_bac_3"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0506"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39287"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0Q4"
FT                   /protein_id="BAF39287.1"
FT                   /translation="MTASIINKTIKSIVAASAALIMAASVAACGPNAATPSEENNASNG
FT                   GVTTSKVTARSLDEIKKSGVLKVAVFSDKAPFGYIDKDGKNAGYDIVFAERLAKDLGVK
FT                   VKYTSVDPAARVDVLTSNKVDITLANFTVTDERKEKVDFAKPYMKVALGVVSPENAEIT
FT                   DVSQLKGKTLIIAKGTTAESYFEKNEPDVKLQKYDQYADAYNALLDGRGDAFSTDNTEV
FT                   LAWAKTNKGFKVGITKLGDEDTIAPAVQKGNKELLNWINDEIVKLGKENFFHKDYEETL
FT                   KPVYGSDVNPDDIVVEGGQL"
     MTASIINKTI KSIVAASAAL IMAASVAACG PNAATPSEEN NASNGGVTTS KVTARSLDEI        60
     KKSGVLKVAV FSDKAPFGYI DKDGKNAGYD IVFAERLAKD LGVKVKYTSV DPAARVDVLT       120
     SNKVDITLAN FTVTDERKEK VDFAKPYMKV ALGVVSPENA EITDVSQLKG KTLIIAKGTT       180
     AESYFEKNEP DVKLQKYDQY ADAYNALLDG RGDAFSTDNT EVLAWAKTNK GFKVGITKLG       240
     DEDTIAPAVQ KGNKELLNWI NDEIVKLGKE NFFHKDYEET LKPVYGSDVN PDDIVVEGGQ       300
     L                                                                       301
//

If you have problems or comments...

PBIL Back to PBIL home page