(data stored in ACNUC30630 zone)

EMBL: AP009256.PE561

AP009256.PE561       Location/Qualifiers
FT   CDS             complement(702488..703441)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0561"
FT                   /product="hypothetical protein"
FT                   /note="COG family: uncharacterized Acr"
FT                   /note="Orthologue of BL1810"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0561"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39342"
FT                   /db_xref="InterPro:IPR002881"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0V9"
FT                   /protein_id="BAF39342.1"
FT                   /translation="MIDQIRSDDPIRRKIETLGTTLSLPTVRKALGILEGAHASNKRFG
FT                   ADDVVDIHAYEPGDEAKRIDWKTSARAGRPMVVQRERPSTSKAWLLLDVGQEMTAACPS
FT                   SEQAYQVAANALCMFAALSLRRGDEVSMVFGDSASITRVPFNGGLAQFERTLDTALQRE
FT                   WTRPRNIDALLEYARRIRDKEALVVIATEEHALEERHLSAIRMIARTHPMVLIDVATIN
FT                   PFDVSHARVVLDGAGKRRVPAFLRRGNTAGQVRTHREYLAASIRHELNRCGSTVIRSDS
FT                   SERMFHEFVRMVSTALAQSTRNQLRAPSVLSLGDKA"
     MIDQIRSDDP IRRKIETLGT TLSLPTVRKA LGILEGAHAS NKRFGADDVV DIHAYEPGDE        60
     AKRIDWKTSA RAGRPMVVQR ERPSTSKAWL LLDVGQEMTA ACPSSEQAYQ VAANALCMFA       120
     ALSLRRGDEV SMVFGDSASI TRVPFNGGLA QFERTLDTAL QREWTRPRNI DALLEYARRI       180
     RDKEALVVIA TEEHALEERH LSAIRMIART HPMVLIDVAT INPFDVSHAR VVLDGAGKRR       240
     VPAFLRRGNT AGQVRTHREY LAASIRHELN RCGSTVIRSD SSERMFHEFV RMVSTALAQS       300
     TRNQLRAPSV LSLGDKA                                                      317
//

If you have problems or comments...

PBIL Back to PBIL home page