(data stored in ACNUC30630 zone)

EMBL: AP009256.PE585

AP009256.PE585       Location/Qualifiers
FT   CDS             732473..733873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0585"
FT                   /product="hypothetical protein"
FT                   /note="COG family: uncharacterized ATPase related to
FT                   thehelicase subunit of the holliday junction resolvase"
FT                   /note="Orthologue of BL0029"
FT                   /note="PFAM_ID: AAA"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0585"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39366"
FT                   /db_xref="GOA:A1A0Y3"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR021886"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032423"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0Y3"
FT                   /protein_id="BAF39366.1"
FT                   /translation="MTDDLFAAMDAPDDVTRPLAVRMRPASIDDVVGQSRVLGEGSPLR
FT                   RLANPASKGSLTAPSSIILFGPPGVGKTTLAYIVAKQSGRVFEELSAVTSGVKDVRDVL
FT                   KRAHERLVSEGKETVLFIDEVHRFSKSQQDALLPSVENRDVTFIAATTENPSFSVIKPL
FT                   LSRSVVVKLESLEPDDLKTLINRAIASEHGLDNEIRITDEAVDEIIRMAGGDARKTLTI
FT                   LEAAAGALTGDKERKKGAKRPIITPDVVSKVMDVATVRYDKDGDDHYDVISAFIKSMRG
FT                   SDPDATMHYLARMLRAGEDPRFIARRIMIAASEEVGMAAPQVLQVTVAAAQAVAMIGMP
FT                   EARIILAEAALAVATAPKSNASYNAINAALADVDAGLIGQVPLHLRNAPTALMKSWGNH
FT                   EGYRYAHDWPGAVAPQQYMPDELQGREYYHPNDRGYEHEVKPRLERIRKILHEEDDNGD
FT                   GRSGQRNA"
     MTDDLFAAMD APDDVTRPLA VRMRPASIDD VVGQSRVLGE GSPLRRLANP ASKGSLTAPS        60
     SIILFGPPGV GKTTLAYIVA KQSGRVFEEL SAVTSGVKDV RDVLKRAHER LVSEGKETVL       120
     FIDEVHRFSK SQQDALLPSV ENRDVTFIAA TTENPSFSVI KPLLSRSVVV KLESLEPDDL       180
     KTLINRAIAS EHGLDNEIRI TDEAVDEIIR MAGGDARKTL TILEAAAGAL TGDKERKKGA       240
     KRPIITPDVV SKVMDVATVR YDKDGDDHYD VISAFIKSMR GSDPDATMHY LARMLRAGED       300
     PRFIARRIMI AASEEVGMAA PQVLQVTVAA AQAVAMIGMP EARIILAEAA LAVATAPKSN       360
     ASYNAINAAL ADVDAGLIGQ VPLHLRNAPT ALMKSWGNHE GYRYAHDWPG AVAPQQYMPD       420
     ELQGREYYHP NDRGYEHEVK PRLERIRKIL HEEDDNGDGR SGQRNA                      466
//

If you have problems or comments...

PBIL Back to PBIL home page