(data stored in ACNUC30630 zone)

EMBL: AP009256.PE610

AP009256.PE610       Location/Qualifiers
FT   CDS             764901..765329
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0610"
FT                   /product="hypothetical protein"
FT                   /note="Orthologue of PAB3260"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0610"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39391"
FT                   /db_xref="GOA:A1A108"
FT                   /db_xref="InterPro:IPR007167"
FT                   /db_xref="InterPro:IPR008988"
FT                   /db_xref="InterPro:IPR038157"
FT                   /db_xref="UniProtKB/TrEMBL:A1A108"
FT                   /protein_id="BAF39391.1"
FT                   /translation="MRQALGPVGSGAFRVKDLYIAVFPAKGGTMSTSRAVRDAANPTMT
FT                   LHDCPLNARVVVDGIDLDDRHRFRLCEIGLAPGTGLRVVQRGAFGGRVIAFGNERVAVD
FT                   GGTARAVRVRFAQDWAVQDSAAQDKTARHEENGNTHEC"
     MRQALGPVGS GAFRVKDLYI AVFPAKGGTM STSRAVRDAA NPTMTLHDCP LNARVVVDGI        60
     DLDDRHRFRL CEIGLAPGTG LRVVQRGAFG GRVIAFGNER VAVDGGTARA VRVRFAQDWA       120
     VQDSAAQDKT ARHEENGNTH EC                                                142
//

If you have problems or comments...

PBIL Back to PBIL home page