(data stored in ACNUC30630 zone)

EMBL: AP009256.PE611

AP009256.PE611       Location/Qualifiers
FT   CDS             765467..767434
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0611"
FT                   /product="ferrous iron transport protein B"
FT                   /note="Orthologue of DR1219"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0611"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39392"
FT                   /db_xref="GOA:A1A109"
FT                   /db_xref="InterPro:IPR003373"
FT                   /db_xref="InterPro:IPR011640"
FT                   /db_xref="InterPro:IPR011642"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030389"
FT                   /db_xref="UniProtKB/TrEMBL:A1A109"
FT                   /protein_id="BAF39392.1"
FT                   /translation="MTRRVVFVGNPNVGKSSMFNALLGARTRTMNAPGTTVSITCGQYH
FT                   YEKPKTAGNAQNWQFVDTPGTYSLAPMSPDEQVAVNALTGMSGMPVPDLAVVVLDATAL
FT                   SRSLYLLSMVVELGLPTVVALTMNDLAVRNGCGVDAERLSHLLDGMPVVAIDGRTGDGG
FT                   KALADAIAASFEGTPVPHGLTALPTVTADADMKTADGLSVWAELRADARLDWTAGILRG
FT                   LDMHAVDHVTLSDRIDRVLLHPVIGVLVFLAVLFVVFQATTTLASPMQDWIDVTFRGWC
FT                   TDGLDLLLGLFGPSVSGGWLRSLLVDGLLDGVVTVLTFIPVMGIMFLLLSILEDSGYMA
FT                   RAAFVMDRAMRALGLDGRAFLPIIVGFGCNLPALAATRTLSDSRQRVLTGMLVPFAACS
FT                   ARLSVFLVLAHAFFPKYAGLVVFLMYVASVMVILLVGVLLRHTMFRGLEPEPLMLALPA
FT                   YQCPRALQLARSVLLRLWGFIRGASVIIISMITALWLLQGIPVTANAGGFAHVDDVHDS
FT                   AYGVLADAVAPVFAPAGFDDWHASAALITGFVAKEVVVGSMSQSYHADEPDDAASQQAG
FT                   EGTLGQKLRASFDQSSHGHGKAAAIAFLLFTLAYTPCLATVAEMRRQFGTKVAARSVLL
FT                   SLAVAYVIAIIAFQTLRLIW"
     MTRRVVFVGN PNVGKSSMFN ALLGARTRTM NAPGTTVSIT CGQYHYEKPK TAGNAQNWQF        60
     VDTPGTYSLA PMSPDEQVAV NALTGMSGMP VPDLAVVVLD ATALSRSLYL LSMVVELGLP       120
     TVVALTMNDL AVRNGCGVDA ERLSHLLDGM PVVAIDGRTG DGGKALADAI AASFEGTPVP       180
     HGLTALPTVT ADADMKTADG LSVWAELRAD ARLDWTAGIL RGLDMHAVDH VTLSDRIDRV       240
     LLHPVIGVLV FLAVLFVVFQ ATTTLASPMQ DWIDVTFRGW CTDGLDLLLG LFGPSVSGGW       300
     LRSLLVDGLL DGVVTVLTFI PVMGIMFLLL SILEDSGYMA RAAFVMDRAM RALGLDGRAF       360
     LPIIVGFGCN LPALAATRTL SDSRQRVLTG MLVPFAACSA RLSVFLVLAH AFFPKYAGLV       420
     VFLMYVASVM VILLVGVLLR HTMFRGLEPE PLMLALPAYQ CPRALQLARS VLLRLWGFIR       480
     GASVIIISMI TALWLLQGIP VTANAGGFAH VDDVHDSAYG VLADAVAPVF APAGFDDWHA       540
     SAALITGFVA KEVVVGSMSQ SYHADEPDDA ASQQAGEGTL GQKLRASFDQ SSHGHGKAAA       600
     IAFLLFTLAY TPCLATVAEM RRQFGTKVAA RSVLLSLAVA YVIAIIAFQT LRLIW            655
//

If you have problems or comments...

PBIL Back to PBIL home page