(data stored in ACNUC30630 zone)

EMBL: AP009256.PE65

AP009256.PE65        Location/Qualifiers
FT   CDS             complement(85326..88037)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0065"
FT                   /product="hypothetical protein"
FT                   /note="COG family: predicted membrane protein"
FT                   /note="Orthologue of BL0138"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0065"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38846"
FT                   /db_xref="GOA:A0ZZG3"
FT                   /db_xref="InterPro:IPR017500"
FT                   /db_xref="InterPro:IPR017501"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZG3"
FT                   /protein_id="BAF38846.1"
FT                   /translation="MHQVFAIFLRDVKRILKNPVALVVTLGVAIIPSLYAWCNILANWD
FT                   PYANTGNIQVAVANEDKGTTSTLVGHLDAGQQTVNQLKKNHQLGWRFVPKQQAIEGVES
FT                   GKYYAAIVLPEDFSSRLIGTVTGKGDRPSITYYINEKLNAIAPKITDTGATTIDEQINT
FT                   TFVSSVADAVAKEVKEAAGETTGSVKSAQSDVINDLTDTINQLETVQQQLRDTRSTLDK
FT                   ALTTIDSAKQSNIALTSEITNSLDTVGKASDLLSETRTQTERFSNTLVGALDNGSTQLS
FT                   GLQVNVSNATGTVLSGLNTTQDALDQVSSTMHHVNTTTGNVLDDVEKALQASQLDPNSQ
FT                   TYKDLSAQLAEARKQLTFQQQRIDAFDQDTTAAINAGKNTANGFNDDVTTLAKNGTASM
FT                   ASARTTITGTVMPNLNTGLDTLSLANGSLSGTLTTLQSTLEQGNGLLDQLSRTVTQTNT
FT                   TIAGTQTQLANLAKQLNTTRTDVAALSSSAMFQQLSQALGLDASEVGSFVGEPVHLDEQ
FT                   VLYPVKNYGSAVTPFYTNLALWVGGFVLVAIYKLEVDRDEKIRMYTPRQGYMGRWLLFV
FT                   TVGFLQAIIATIGDLALGIQCEHPFLFILAGIFASFVYVNIIYALAVAFRHIGKAVAVI
FT                   LVIIQIPGAAGLYPIEMMPEFFRRLKPFLPFTYGINAMRGPIGGMYANHYWIDMLSLFW
FT                   YLPVALFIGLVVRKLALNLNRLFDNRLADTDLMITEHNEGTVEPLRLTETAQQIAEEFP
FT                   ELVRRRAIHFFRLYPRLVRWGFLALAVLPFVFLLLLFITRMKLAMLLGWIISIIAIDTY
FT                   LIVVEYLRERYANYLGEEAMSAEEFRSAILHENLLFRPGMHYKPMHAVRTRLYEAAHGG
FT                   SAGHAPEHAAEYAAGNTDGNAGRSLREEGNEQ"
     MHQVFAIFLR DVKRILKNPV ALVVTLGVAI IPSLYAWCNI LANWDPYANT GNIQVAVANE        60
     DKGTTSTLVG HLDAGQQTVN QLKKNHQLGW RFVPKQQAIE GVESGKYYAA IVLPEDFSSR       120
     LIGTVTGKGD RPSITYYINE KLNAIAPKIT DTGATTIDEQ INTTFVSSVA DAVAKEVKEA       180
     AGETTGSVKS AQSDVINDLT DTINQLETVQ QQLRDTRSTL DKALTTIDSA KQSNIALTSE       240
     ITNSLDTVGK ASDLLSETRT QTERFSNTLV GALDNGSTQL SGLQVNVSNA TGTVLSGLNT       300
     TQDALDQVSS TMHHVNTTTG NVLDDVEKAL QASQLDPNSQ TYKDLSAQLA EARKQLTFQQ       360
     QRIDAFDQDT TAAINAGKNT ANGFNDDVTT LAKNGTASMA SARTTITGTV MPNLNTGLDT       420
     LSLANGSLSG TLTTLQSTLE QGNGLLDQLS RTVTQTNTTI AGTQTQLANL AKQLNTTRTD       480
     VAALSSSAMF QQLSQALGLD ASEVGSFVGE PVHLDEQVLY PVKNYGSAVT PFYTNLALWV       540
     GGFVLVAIYK LEVDRDEKIR MYTPRQGYMG RWLLFVTVGF LQAIIATIGD LALGIQCEHP       600
     FLFILAGIFA SFVYVNIIYA LAVAFRHIGK AVAVILVIIQ IPGAAGLYPI EMMPEFFRRL       660
     KPFLPFTYGI NAMRGPIGGM YANHYWIDML SLFWYLPVAL FIGLVVRKLA LNLNRLFDNR       720
     LADTDLMITE HNEGTVEPLR LTETAQQIAE EFPELVRRRA IHFFRLYPRL VRWGFLALAV       780
     LPFVFLLLLF ITRMKLAMLL GWIISIIAID TYLIVVEYLR ERYANYLGEE AMSAEEFRSA       840
     ILHENLLFRP GMHYKPMHAV RTRLYEAAHG GSAGHAPEHA AEYAAGNTDG NAGRSLREEG       900
     NEQ                                                                     903
//

If you have problems or comments...

PBIL Back to PBIL home page