(data stored in ACNUC30630 zone)

EMBL: AP009256.PE68

AP009256.PE68        Location/Qualifiers
FT   CDS             90933..92660
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0068"
FT                   /product="probable voltage gated channel protein"
FT                   /note="COG family: chloride channel protein EriC"
FT                   /note="Orthologue of BL0548"
FT                   /note="PFAM_ID: TrkA"
FT                   /note="PFAM_ID:voltage_CLC"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0068"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38849"
FT                   /db_xref="GOA:A0ZZG6"
FT                   /db_xref="InterPro:IPR001807"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR014743"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZG6"
FT                   /protein_id="BAF38849.1"
FT                   /translation="MTSAGGPVPAGTLRMVRAMACAYDAHRIHTDGVRGGGTEKGSAMT
FT                   AMPPNDRFDRFDRFSKLVPRFDHLKWKMAAAGILVGLISGFLVVLYRLGIEYGTDTARW
FT                   IYARIRETPWLVAPWAVAAITAALAIAWMVKKEPMAGGSGIPQTNGVVICGLKMRWQTI
FT                   LPVRFIGGLLGSLFGLSLGREGPSIQIGASGAQFLSHRLRGKKREDMQEHYLVTAGAAA
FT                   GLSAAFSAPLSGMMFALEGVHRSFSPAILMGATAASLTADFVSKYCFGLRPVLDFGTIG
FT                   QLPLGEYGWLIPLGLVAGLVGSLMNRSLLGFQTLYGKLPAWSRPLIAIALALPIGIWLP
FT                   DVLGGGSNLIAMAEHARVGLGMLCVLFVAKVLFTSTSFGSGAPGGIFMPILAVGSLAGG
FT                   ICGETLHQFGNLPSDSVAIFSVCVMTGTLAASVKTPITSILLAVEMSGTLTHMLPVAAV
FT                   AFIALLVSDLLRTKPIYGELLERYMRAQGGTTAIANRIDNGIMELPVEMGATADGKLMR
FT                   DVRWPYGCLVIGLRRGERQIVPHGDTRLRAGDYLVVLFSGEDESDARHAMRRLCDVSV"
     MTSAGGPVPA GTLRMVRAMA CAYDAHRIHT DGVRGGGTEK GSAMTAMPPN DRFDRFDRFS        60
     KLVPRFDHLK WKMAAAGILV GLISGFLVVL YRLGIEYGTD TARWIYARIR ETPWLVAPWA       120
     VAAITAALAI AWMVKKEPMA GGSGIPQTNG VVICGLKMRW QTILPVRFIG GLLGSLFGLS       180
     LGREGPSIQI GASGAQFLSH RLRGKKREDM QEHYLVTAGA AAGLSAAFSA PLSGMMFALE       240
     GVHRSFSPAI LMGATAASLT ADFVSKYCFG LRPVLDFGTI GQLPLGEYGW LIPLGLVAGL       300
     VGSLMNRSLL GFQTLYGKLP AWSRPLIAIA LALPIGIWLP DVLGGGSNLI AMAEHARVGL       360
     GMLCVLFVAK VLFTSTSFGS GAPGGIFMPI LAVGSLAGGI CGETLHQFGN LPSDSVAIFS       420
     VCVMTGTLAA SVKTPITSIL LAVEMSGTLT HMLPVAAVAF IALLVSDLLR TKPIYGELLE       480
     RYMRAQGGTT AIANRIDNGI MELPVEMGAT ADGKLMRDVR WPYGCLVIGL RRGERQIVPH       540
     GDTRLRAGDY LVVLFSGEDE SDARHAMRRL CDVSV                                  575
//

If you have problems or comments...

PBIL Back to PBIL home page