(data stored in ACNUC30630 zone)

EMBL: AP009256.PE87

AP009256.PE87        Location/Qualifiers
FT   CDS             122116..122919
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0087"
FT                   /product="possible sortase-like protein"
FT                   /note="COG family: sortase (surface proteintranspeptidase)"
FT                   /note="Orthologue of BL0498"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0087"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38868"
FT                   /db_xref="GOA:A0ZZI5"
FT                   /db_xref="InterPro:IPR023365"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZI5"
FT                   /protein_id="BAF38868.1"
FT                   /translation="MGARGGSRSDGPQQIKDLRADDFYGDSHDGNDGSRGPHDTTRNTC
FT                   TYTLPTFAEATDASEAMRERRADRNKSIAMRVLAAVLILTALGIGMFPRVLQYRSAREL
FT                   ASTSARSEKRVAGWPYPQADEAFAAAREYNKRLAKSGQPVIGEAKDPLAELYDDPQNAA
FT                   NNASADGSDNSSDSASAKDTEYQSLLDSGDGVMGAIRIPKISVNLPVYHGTSELTLASG
FT                   AGHLYGSSLPVGSTPKPPSASSDSRPAASTRCSAKTKTSAPNSTS"
     MGARGGSRSD GPQQIKDLRA DDFYGDSHDG NDGSRGPHDT TRNTCTYTLP TFAEATDASE        60
     AMRERRADRN KSIAMRVLAA VLILTALGIG MFPRVLQYRS ARELASTSAR SEKRVAGWPY       120
     PQADEAFAAA REYNKRLAKS GQPVIGEAKD PLAELYDDPQ NAANNASADG SDNSSDSASA       180
     KDTEYQSLLD SGDGVMGAIR IPKISVNLPV YHGTSELTLA SGAGHLYGSS LPVGSTPKPP       240
     SASSDSRPAA STRCSAKTKT SAPNSTS                                           267
//

If you have problems or comments...

PBIL Back to PBIL home page