(data stored in ACNUC30630 zone)

EMBL: AP009256.PE90

AP009256.PE90        Location/Qualifiers
FT   CDS             complement(125855..126568)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0090"
FT                   /product="thiamine biosynthesis protein ThiF"
FT                   /note="Catalyzes the adenylation of ThiS which is
FT                   involvedin the formation of
FT                   5-methyl-4-(beta-hydroxyethyl)thiazolephosphate"
FT                   /note="Orthologue of CAC2923"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0090"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38871"
FT                   /db_xref="GOA:A0ZZI8"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR012729"
FT                   /db_xref="InterPro:IPR035985"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZI8"
FT                   /protein_id="BAF38871.1"
FT                   /translation="MTFEPSASQAQIDARQHAFDNQPDPATLVSREEIRAALLDRHTAA
FT                   TQDKLDAAHVAICGCGGLGSTIAVALTRIGVGHLHLIDFDRVDMTNLNRQQYFLKDLGQ
FT                   YKTEALRSNLRQINPFTDITIDTVKVTDENVPTLFENEDIICEAFDVPENKTMLVNAVL
FT                   ENLPGKKLVSASGMAGFRSSNLVSTRRVSKNFYFCGDGETAPVPGAGLMAPRVGVVACH
FT                   EANMITRLILGEEDA"
     MTFEPSASQA QIDARQHAFD NQPDPATLVS REEIRAALLD RHTAATQDKL DAAHVAICGC        60
     GGLGSTIAVA LTRIGVGHLH LIDFDRVDMT NLNRQQYFLK DLGQYKTEAL RSNLRQINPF       120
     TDITIDTVKV TDENVPTLFE NEDIICEAFD VPENKTMLVN AVLENLPGKK LVSASGMAGF       180
     RSSNLVSTRR VSKNFYFCGD GETAPVPGAG LMAPRVGVVA CHEANMITRL ILGEEDA          237
//

If you have problems or comments...

PBIL Back to PBIL home page