(data stored in ACNUC30630 zone)

EMBL: AP009256.PE93

AP009256.PE93        Location/Qualifiers
FT   CDS             129076..130827
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0093"
FT                   /product="probable permease protein of ABC transporter
FT                   system"
FT                   /note="COG family: ABC-type
FT                   multidrug_protein_lipidtransport system_ ATPase component"
FT                   /note="Orthologue of BL0162"
FT                   /note="PFAM_ID: ABC_membrane"
FT                   /note="PFAM_ID: ABC_tran"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0093"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38874"
FT                   /db_xref="GOA:A0ZZJ1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZJ1"
FT                   /protein_id="BAF38874.1"
FT                   /translation="MLRIVRYLSKAEIGQMLVALVSIVGQIWLDLTLPDYMADITQLVE
FT                   TPGSEMHDIWVAGGKMLLVSLGSAACAVVTGFIAARVGASFSQRLRSLEFNKVESFGPA
FT                   EMNRFSTASLITRSTNDITQIQMFITMGLMMIVKAPIMAVWAVCKIAGKGFDWTLATGI
FT                   AVAILLVVIAVLMHFVMPKFKAMQRLTDNINLVARENLTGLRVVRAYNAEDYQEAKFTE
FT                   ANKELTETQLFTNRAMAIMMPLMNTIMNGLMLAVYWIGAYLIDAAEAVDKLTTFSDMVV
FT                   FSSYSIQVIMSFLLLSMVFVLWPRADVSAQRVLEVIDTEPMVTDGTQDAGKPGEEGEIE
FT                   FRNVSFAYPDSRHAMLEGVNFKAKKGQTVAFIGSTGSGKSSLINLVPRFYDATQGEVLV
FT                   DGVNVRDYKLKALRDKIGYVPQQSFLFKGTIASNVAYGDTDRDDDTVRRACDVAQATEF
FT                   IDKKQKKYDSGISQGGSNVSGGQKQRLSIARAVYRHPEILIFDDSFSALDFKTDRAVRD
FT                   ALEKEAKDSTKLIVAQRIGTIMNADRIIVLDDGKVVGQGTHEELLDTCEVYRQIAESQL
FT                   SEDELKR"
     MLRIVRYLSK AEIGQMLVAL VSIVGQIWLD LTLPDYMADI TQLVETPGSE MHDIWVAGGK        60
     MLLVSLGSAA CAVVTGFIAA RVGASFSQRL RSLEFNKVES FGPAEMNRFS TASLITRSTN       120
     DITQIQMFIT MGLMMIVKAP IMAVWAVCKI AGKGFDWTLA TGIAVAILLV VIAVLMHFVM       180
     PKFKAMQRLT DNINLVAREN LTGLRVVRAY NAEDYQEAKF TEANKELTET QLFTNRAMAI       240
     MMPLMNTIMN GLMLAVYWIG AYLIDAAEAV DKLTTFSDMV VFSSYSIQVI MSFLLLSMVF       300
     VLWPRADVSA QRVLEVIDTE PMVTDGTQDA GKPGEEGEIE FRNVSFAYPD SRHAMLEGVN       360
     FKAKKGQTVA FIGSTGSGKS SLINLVPRFY DATQGEVLVD GVNVRDYKLK ALRDKIGYVP       420
     QQSFLFKGTI ASNVAYGDTD RDDDTVRRAC DVAQATEFID KKQKKYDSGI SQGGSNVSGG       480
     QKQRLSIARA VYRHPEILIF DDSFSALDFK TDRAVRDALE KEAKDSTKLI VAQRIGTIMN       540
     ADRIIVLDDG KVVGQGTHEE LLDTCEVYRQ IAESQLSEDE LKR                         583
//

If you have problems or comments...

PBIL Back to PBIL home page