(data stored in ACNUC30630 zone)

EMBL: AP009256.PE98

AP009256.PE98        Location/Qualifiers
FT   CDS             137242..137901
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0098"
FT                   /product="hypothetical protein"
FT                   /note="COG family: predicted periplasmic_secreted protein"
FT                   /note="Orthologue of BL0454"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0098"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38879"
FT                   /db_xref="InterPro:IPR018470"
FT                   /db_xref="InterPro:IPR038482"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZJ6"
FT                   /protein_id="BAF38879.1"
FT                   /translation="MKNKKIAALLGILLAGSMAFSLSACGNSSDSAASDKSSASASASK
FT                   ADDSSKDDSSDSAGFEEIQVDEKHSDQECGPLTVNAVYFQPIDMEPSGMGLKAADASFH
FT                   LEADIHANQKGTELGYGKGDFVPDLTVNYDIIDKTSNASVASGTFMQMNASDGPHYGAN
FT                   VKLDKAGAYKLVLKIESPEKKGWMLHVDPETGVKGRFWTEPIEVTFPDWNYTPQEW"
     MKNKKIAALL GILLAGSMAF SLSACGNSSD SAASDKSSAS ASASKADDSS KDDSSDSAGF        60
     EEIQVDEKHS DQECGPLTVN AVYFQPIDME PSGMGLKAAD ASFHLEADIH ANQKGTELGY       120
     GKGDFVPDLT VNYDIIDKTS NASVASGTFM QMNASDGPHY GANVKLDKAG AYKLVLKIES       180
     PEKKGWMLHV DPETGVKGRF WTEPIEVTFP DWNYTPQEW                              219
//

If you have problems or comments...

PBIL Back to PBIL home page