(data stored in ACNUC30630 zone)

EMBL: AP009256.PSTC

AP009256.PSTC        Location/Qualifiers
FT   CDS             370893..371846
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pstC"
FT                   /locus_tag="BAD_0279"
FT                   /product="probable phosphate permease protein of ABC
FT                   transporter system"
FT                   /note="COG family: ABC-type phosphate transportsystem_
FT                   permease component"
FT                   /note="Orthologue of BL0314"
FT                   /note="PFAM_ID: BPD_transp"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0279"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39060"
FT                   /db_xref="GOA:A1A027"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR011864"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A1A027"
FT                   /protein_id="BAF39060.1"
FT                   /translation="MSSQSKTAQQPVSGKNADKVFKGVAYACGILILVVLAAVALFLLF
FT                   RAWPLIGGDQKANSATISNFTGGKASSFWGYVGPLLFGTVLISALALLISFFVSVGIAL
FT                   FISHYAPKKLATALSYVVDLLAAIPSVIYGLWGGLVLVPAIYPFWNWVAKYLGWIPIFA
FT                   GPAANPSRTVATVSVVLAVMILPIITSMSRDIFLQTPRLQEEAALALGATKWEMVKLAV
FT                   LPFGKSGVVSASMLGLGRALGETMAVLMILSPGLNYSVKLLQASQNQTIAANIAAQYPE
FT                   ANDLGVSVLIGTGLVLFLITFVVNFIARKLTEKASA"
     MSSQSKTAQQ PVSGKNADKV FKGVAYACGI LILVVLAAVA LFLLFRAWPL IGGDQKANSA        60
     TISNFTGGKA SSFWGYVGPL LFGTVLISAL ALLISFFVSV GIALFISHYA PKKLATALSY       120
     VVDLLAAIPS VIYGLWGGLV LVPAIYPFWN WVAKYLGWIP IFAGPAANPS RTVATVSVVL       180
     AVMILPIITS MSRDIFLQTP RLQEEAALAL GATKWEMVKL AVLPFGKSGV VSASMLGLGR       240
     ALGETMAVLM ILSPGLNYSV KLLQASQNQT IAANIAAQYP EANDLGVSVL IGTGLVLFLI       300
     TFVVNFIARK LTEKASA                                                      317
//

If you have problems or comments...

PBIL Back to PBIL home page