(data stored in ACNUC30630 zone)

EMBL: AP009256.PTSI

AP009256.PTSI        Location/Qualifiers
FT   CDS             225852..227546
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ptsI"
FT                   /locus_tag="BAD_0166"
FT                   /product="PTS system, enzyme I"
FT                   /note="Identified by sequence similarity"
FT                   /note="Orthologue of Lxx00830"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0166"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38947"
FT                   /db_xref="GOA:A0ZZR4"
FT                   /db_xref="InterPro:IPR000121"
FT                   /db_xref="InterPro:IPR006318"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR008731"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018274"
FT                   /db_xref="InterPro:IPR023151"
FT                   /db_xref="InterPro:IPR024692"
FT                   /db_xref="InterPro:IPR036618"
FT                   /db_xref="InterPro:IPR036637"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZR4"
FT                   /protein_id="BAF38947.1"
FT                   /translation="MRIHIFSKETGKGVLMNIKGVGIGRGVAVGPVIRMAAPLPEPSDA
FT                   PRAENISAETEIARVEKSLALVNADLNRRAEEAANGDEGAKQAAPILQAIAMFASDPSL
FT                   AQSIKDLINQGKTAERAVLEGFGAVEDMFRAIGGYQAERAADLHDVGQRVIADLMGAPA
FT                   PGLPVSETPFVLVAEDLSPADTAALDMSKTLAIVTSQGGPTSHTAILARARGIVAVVSA
FT                   AEAAELENGTNVIVNAAKGEIVVNPSEDEIAAAEAAKSRAAAAKELRGKPGATKDGHLI
FT                   PLLANVGKPSDAAKALEYGAEGVGLFRTEFLFIGNSEPPSVEEQTKAYTELLSQFPGKK
FT                   VVIRMLDAGADKPLPFLTPEDEPNPALGLRGLRTLRAHMDVLEGQLKALAAADAATDAN
FT                   LWVMAPMVADQHEADYFVKLGKSFGLKFVGAMAEVPSIALMADKVADVADFVSIGTNDL
FT                   TQYTLAADRTLGSVANYQTAWHPAVLRAIKMICDAGNAKGMPVGVCGEAAADPDLAVVL
FT                   AGLGVNSLSMTPVALDDVRASLAEVTFEEAKAKAAAALNGDFYKPAE"
     MRIHIFSKET GKGVLMNIKG VGIGRGVAVG PVIRMAAPLP EPSDAPRAEN ISAETEIARV        60
     EKSLALVNAD LNRRAEEAAN GDEGAKQAAP ILQAIAMFAS DPSLAQSIKD LINQGKTAER       120
     AVLEGFGAVE DMFRAIGGYQ AERAADLHDV GQRVIADLMG APAPGLPVSE TPFVLVAEDL       180
     SPADTAALDM SKTLAIVTSQ GGPTSHTAIL ARARGIVAVV SAAEAAELEN GTNVIVNAAK       240
     GEIVVNPSED EIAAAEAAKS RAAAAKELRG KPGATKDGHL IPLLANVGKP SDAAKALEYG       300
     AEGVGLFRTE FLFIGNSEPP SVEEQTKAYT ELLSQFPGKK VVIRMLDAGA DKPLPFLTPE       360
     DEPNPALGLR GLRTLRAHMD VLEGQLKALA AADAATDANL WVMAPMVADQ HEADYFVKLG       420
     KSFGLKFVGA MAEVPSIALM ADKVADVADF VSIGTNDLTQ YTLAADRTLG SVANYQTAWH       480
     PAVLRAIKMI CDAGNAKGMP VGVCGEAAAD PDLAVVLAGL GVNSLSMTPV ALDDVRASLA       540
     EVTFEEAKAK AAAALNGDFY KPAE                                              564
//

If you have problems or comments...

PBIL Back to PBIL home page