(data stored in ACNUC30630 zone)

EMBL: AP009256.RIBAB

AP009256.RIBAB       Location/Qualifiers
FT   CDS             complement(16714..17352)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ribAB"
FT                   /locus_tag="BAD_0013"
FT                   /product="3,4-dihydroxy-2-butanone 4-phosphate synthase"
FT                   /note="Identified by sequence similarity"
FT                   /note="ORF located using Blastx"
FT                   /note="Orthologue of IL1869_ MHP7448_0272"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0013"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38794"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZB1"
FT                   /protein_id="BAF38794.1"
FT                   /translation="MNLHKKIAFTTVLVAILAFSGTPSAMASTSGHDRSAFNSSAEVAL
FT                   QEKLSNIASTNNLDVEFGEFKIDAPQSTIDEYHGDANLYAESIAKAYEEDTASNTRETK
FT                   NASTRGTATYTSSVFSGVPAGGACWVKQDFRATVTNYKVTSKSLLGSSYQTGVCVFQWS
FT                   PNYSWFEGNLNVLSKGTFHAVVKGGPVSFAATFKAFFHTNKTSLYQEFQ"
     MNLHKKIAFT TVLVAILAFS GTPSAMASTS GHDRSAFNSS AEVALQEKLS NIASTNNLDV        60
     EFGEFKIDAP QSTIDEYHGD ANLYAESIAK AYEEDTASNT RETKNASTRG TATYTSSVFS       120
     GVPAGGACWV KQDFRATVTN YKVTSKSLLG SSYQTGVCVF QWSPNYSWFE GNLNVLSKGT       180
     FHAVVKGGPV SFAATFKAFF HTNKTSLYQE FQ                                     212
//

If you have problems or comments...

PBIL Back to PBIL home page