(data stored in ACNUC30630 zone)

EMBL: AP009256.RPLL

AP009256.RPLL        Location/Qualifiers
FT   CDS             377373..377753
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplL"
FT                   /locus_tag="BAD_0285"
FT                   /product="50S ribosomal protein L7/L12"
FT                   /note="COG family: ribosomal protein L7_L12"
FT                   /note="Orthologue of BL1550"
FT                   /note="PFAM_ID: Ribosomal_L12"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0285"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39066"
FT                   /db_xref="GOA:A1A033"
FT                   /db_xref="InterPro:IPR000206"
FT                   /db_xref="InterPro:IPR008932"
FT                   /db_xref="InterPro:IPR013823"
FT                   /db_xref="InterPro:IPR014719"
FT                   /db_xref="InterPro:IPR036235"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1A033"
FT                   /protein_id="BAF39066.1"
FT                   /translation="MAKYTNDELLEAFGEMTLVELSEFVKAFEEKFDVEAAAPVAAVAA
FT                   APAAGAAAEEEKDEFDVILSAVGDKKIQVIKAVRAITNLGLAEAKALVDGAPKAVLEKA
FT                   KKEDAEKAKSQLEEAGATVELK"
     MAKYTNDELL EAFGEMTLVE LSEFVKAFEE KFDVEAAAPV AAVAAAPAAG AAAEEEKDEF        60
     DVILSAVGDK KIQVIKAVRA ITNLGLAEAK ALVDGAPKAV LEKAKKEDAE KAKSQLEEAG       120
     ATVELK                                                                  126
//

If you have problems or comments...

PBIL Back to PBIL home page