(data stored in ACNUC30630 zone)

EMBL: AP009256.RPLN

AP009256.RPLN        Location/Qualifiers
FT   CDS             428118..428486
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplN"
FT                   /locus_tag="BAD_0331"
FT                   /product="50S ribosomal protein L14"
FT                   /note="COG family: ribosomal protein L14"
FT                   /note="Orthologue of BL1590"
FT                   /note="PFAM_ID:Ribosomal_L14"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0331"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39112"
FT                   /db_xref="GOA:A1A079"
FT                   /db_xref="InterPro:IPR000218"
FT                   /db_xref="InterPro:IPR005745"
FT                   /db_xref="InterPro:IPR019972"
FT                   /db_xref="InterPro:IPR036853"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1A079"
FT                   /protein_id="BAF39112.1"
FT                   /translation="MIQQETRLHVADNTGAKELLAIRVLGGSKRRYAGIGDVIVASVKD
FT                   AIPGGSVKKGDVVKAVVVRTVKEHRRVDGSYIKFDENAAVILGSGREPKGTRIFGPVGR
FT                   ELRDKRFMKIVSLAPEVI"
     MIQQETRLHV ADNTGAKELL AIRVLGGSKR RYAGIGDVIV ASVKDAIPGG SVKKGDVVKA        60
     VVVRTVKEHR RVDGSYIKFD ENAAVILGSG REPKGTRIFG PVGRELRDKR FMKIVSLAPE       120
     VI                                                                      122
//

If you have problems or comments...

PBIL Back to PBIL home page