(data stored in ACNUC30630 zone)

EMBL: AP009256.RPLO

AP009256.RPLO        Location/Qualifiers
FT   CDS             431897..432343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplO"
FT                   /locus_tag="BAD_0340"
FT                   /product="50S ribosomal protein L15"
FT                   /note="Associates with 23S ribosomal RNA and is involvedin
FT                   50S ribosome assembly"
FT                   /note="Orthologue of BL1599"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0340"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39121"
FT                   /db_xref="GOA:A1A088"
FT                   /db_xref="InterPro:IPR005749"
FT                   /db_xref="InterPro:IPR021131"
FT                   /db_xref="InterPro:IPR030878"
FT                   /db_xref="InterPro:IPR036227"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1A088"
FT                   /protein_id="BAF39121.1"
FT                   /translation="MADILQMHDLKPAPGANKDRIRVGRGEGSKGKTSGRGDKGTKKRY
FT                   QVRPGFEGGQLPLYMRLPKLRGFKNPFKKEYQVVNVAVLAELFPQGGEITVADLVAKGA
FT                   VRNGFPVKVLGDGEVSAAYTLKGVKASASAKSKIEAAGGSISED"
     MADILQMHDL KPAPGANKDR IRVGRGEGSK GKTSGRGDKG TKKRYQVRPG FEGGQLPLYM        60
     RLPKLRGFKN PFKKEYQVVN VAVLAELFPQ GGEITVADLV AKGAVRNGFP VKVLGDGEVS       120
     AAYTLKGVKA SASAKSKIEA AGGSISED                                          148
//

If you have problems or comments...

PBIL Back to PBIL home page