(data stored in ACNUC30630 zone)

EMBL: AP009256.RPLV

AP009256.RPLV        Location/Qualifiers
FT   CDS             425917..426276
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplV"
FT                   /locus_tag="BAD_0326"
FT                   /product="50S ribosomal protein L22"
FT                   /note="COG family: ribosomal protein L22"
FT                   /note="PFAM_ID:Ribosomal_L22"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0326"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39107"
FT                   /db_xref="GOA:A1A074"
FT                   /db_xref="InterPro:IPR001063"
FT                   /db_xref="InterPro:IPR005727"
FT                   /db_xref="InterPro:IPR018260"
FT                   /db_xref="InterPro:IPR036394"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1A074"
FT                   /protein_id="BAF39107.1"
FT                   /translation="MEAKAIARHVRVTPRKARRMVDLIRGKKATEAITILKFAPQDASL
FT                   PVRKVLESAIANARVKADKAGEPFRENDLVVKETYVDEGVTLKRFRARAQGRAARINKR
FT                   TSHITVVVANKEGNR"
     MEAKAIARHV RVTPRKARRM VDLIRGKKAT EAITILKFAP QDASLPVRKV LESAIANARV        60
     KADKAGEPFR ENDLVVKETY VDEGVTLKRF RARAQGRAAR INKRTSHITV VVANKEGNR        119
//

If you have problems or comments...

PBIL Back to PBIL home page