(data stored in ACNUC30630 zone)

EMBL: AP009256.RPLW

AP009256.RPLW        Location/Qualifiers
FT   CDS             424434..424739
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplW"
FT                   /locus_tag="BAD_0323"
FT                   /product="50S ribosomal protein L23"
FT                   /note="COG family: ribosomal protein L23"
FT                   /note="Orthologue of BL1580"
FT                   /note="PFAM_ID:Ribosomal_L23"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0323"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39104"
FT                   /db_xref="GOA:A1A071"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR013025"
FT                   /db_xref="UniProtKB/TrEMBL:A1A071"
FT                   /protein_id="BAF39104.1"
FT                   /translation="MIFMVAIHKPAHDIILKPVVSEKSYALSDRGQYTFVVAPNANKVQ
FT                   IKQAIEEIFNVKVTNVNTLNRAGKRQRTRNGFGQRVNQKRAIVTVAEGQTIDIFGN"
     MIFMVAIHKP AHDIILKPVV SEKSYALSDR GQYTFVVAPN ANKVQIKQAI EEIFNVKVTN        60
     VNTLNRAGKR QRTRNGFGQR VNQKRAIVTV AEGQTIDIFG N                           101
//

If you have problems or comments...

PBIL Back to PBIL home page