(data stored in ACNUC30630 zone)

EMBL: AP009256.RPMD

AP009256.RPMD        Location/Qualifiers
FT   CDS             431709..431894
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmD"
FT                   /locus_tag="BAD_0339"
FT                   /product="50S ribosomal protein L30"
FT                   /note="COG family: ribosomal protein L30_L7e"
FT                   /note="Orthologue of BL1598"
FT                   /note="PFAM_ID: Ribosomal_L30"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0339"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39120"
FT                   /db_xref="GOA:A1A087"
FT                   /db_xref="InterPro:IPR005996"
FT                   /db_xref="InterPro:IPR016082"
FT                   /db_xref="InterPro:IPR036919"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1A087"
FT                   /protein_id="BAF39120.1"
FT                   /translation="MMTNLNIKLHHGLVNSTPKQRAAAQTLGLNKIGKTVTREDTPALR
FT                   GQLQVLRHLITVEEAD"
     MMTNLNIKLH HGLVNSTPKQ RAAAQTLGLN KIGKTVTRED TPALRGQLQV LRHLITVEEA        60
     D                                                                        61
//

If you have problems or comments...

PBIL Back to PBIL home page