(data stored in ACNUC30630 zone)

EMBL: AP009256.RPSO

AP009256.RPSO        Location/Qualifiers
FT   CDS             343552..343821
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsO"
FT                   /locus_tag="BAD_0259"
FT                   /product="30S ribosomal protein S15"
FT                   /note="COG family: ribosomal protein S15p_S13e"
FT                   /note="Orthologue of BL1545a"
FT                   /note="PFAM_ID: Ribosomal_S15"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0259"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39040"
FT                   /db_xref="GOA:A1A007"
FT                   /db_xref="InterPro:IPR000589"
FT                   /db_xref="InterPro:IPR005290"
FT                   /db_xref="InterPro:IPR009068"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1A007"
FT                   /protein_id="BAF39040.1"
FT                   /translation="MALTAEEKQEIIKTYATHEGDTGSPEVQVALLTKRIADLTEHLKE
FT                   HKHDHHSRRGLLLMVGDRRRMLDYLKRVDINRYRSLIERLGLRR"
     MALTAEEKQE IIKTYATHEG DTGSPEVQVA LLTKRIADLT EHLKEHKHDH HSRRGLLLMV        60
     GDRRRMLDYL KRVDINRYRS LIERLGLRR                                          89
//

If you have problems or comments...

PBIL Back to PBIL home page