(data stored in ACNUC30630 zone)

EMBL: AP009256.RPSS

AP009256.RPSS        Location/Qualifiers
FT   CDS             425622..425900
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsS"
FT                   /locus_tag="BAD_0325"
FT                   /product="30S ribosomal protein S19"
FT                   /note="COG family: ribosomal protein S19"
FT                   /note="Orthologue of BL1582"
FT                   /note="PFAM_ID:Ribosomal_S19"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0325"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39106"
FT                   /db_xref="GOA:A1A073"
FT                   /db_xref="InterPro:IPR002222"
FT                   /db_xref="InterPro:IPR005732"
FT                   /db_xref="InterPro:IPR020934"
FT                   /db_xref="InterPro:IPR023575"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1A073"
FT                   /protein_id="BAF39106.1"
FT                   /translation="MTRSIKKGPFVDAHLQKKVDEQNEKGTHNVIKTWSRRSMITPDFI
FT                   GHTFAVHDGRKHVPVFVTESMVGHKLGEFAPTKTFKGHVKDDKKARR"
     MTRSIKKGPF VDAHLQKKVD EQNEKGTHNV IKTWSRRSMI TPDFIGHTFA VHDGRKHVPV        60
     FVTESMVGHK LGEFAPTKTF KGHVKDDKKA RR                                      92
//

If you have problems or comments...

PBIL Back to PBIL home page